SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G03410.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G03410.1
Domain Number 1 Region: 371-641
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-44
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 2 Region: 37-211
Classification Level Classification E-value
Superfamily L domain-like 3.59e-32
Family Polygalacturonase inhibiting protein PGIP 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G03410.1   Gene: BRADI5G03410   Transcript: BRADI5G03410.1
Sequence length 673
Comment pep:novel chromosome:Brachy1.0:5:3960787:3964452:-1 gene:BRADI5G03410 transcript:BRADI5G03410.1
Sequence
MAALPTLLLLALALAITTTNAAAQPTPPQRERLALQAFLAGTPHERSLGWNAPSAPSPCL
WFGVVCDASNATVVAVRLPGVGLVGALPASTLGNLRGLRTLSLRSNRLSGPIPADLLALP
ALRSLYLQGNRLSGRLPGDLPSSLHHLSLSGNELDGEIPESLDGLLELRSLRLDGNKFSG
ALPSLSALRRLEVFNVSYNRLNGSIPSSLGSRFPRESFAGNLQLCGEPLDRPCDESPSPG
VVIPPPVPGNTKKRRLSGAGVTAIAVGAGAGALFALVLFVLCFVHRRRRRDANTNNKMPT
PTPTRGFTPSTAPTSGDMGDITSSSKEIAAAAAAAASGGGESQRSRLVFVGNTHKDGYGF
DLEDLLRASAEVLGKGGGGTSYKAVLEDGTTTVVVKRLKDVAAGRREFAAAVEALGGVEH
RNLLPVRGYYFSKDEKLLIADHLPDGSLSAALHGSRGSGQTPMGWAARVQAALCAARGVA
HLHAAHGLAHGNIKSSNLLLRPRQGDPDAAALLSDYGLQQLFAPPPPSARGGGYRAPELV
DPRRPTPQSDVYSLGVLFLEILTGRSPAAAALDLPRWVQSVVREEWTAEVFDPELVRMGS
GGGAGEEEEMVALLQVAMACAATAPDARPEAPEVVRMLEEIGGGSGSHGHGRATGEVEEE
DRPWGTPPAGATP
Download sequence
Identical sequences I1IW92
XP_003581176.1.954 15368.BRADI5G03410.1 EG:BRADI5G03410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]