SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G03632.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G03632.1
Domain Number 1 Region: 413-709
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-68
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 255-364
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000832
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G03632.1   Gene: BRADI5G03632   Transcript: BRADI5G03632.1
Sequence length 751
Comment pep:novel chromosome:Brachy1.0:5:4437631:4447199:1 gene:BRADI5G03632 transcript:BRADI5G03632.1
Sequence
MPQALFLLLVMSCAALLGEGVSGSGDSASTAPAMLPVPPPNCPSNCGKVDIPYPFGIGAS
ECFRAPTFELTCDETTNPPGLYSGDLLVANISMETAEITVYYRGLTSTCNDPDNRTAPPS
NVGVRLRSGTAFLISTAGNTFTAVGCGAEARINGNYGTYRTGCMTYCARASESAGDGTPC
RGNGCCEASLTADLKEFSVKWVDDFKSPAFNPCQYAFVAKNGWYSFNKSDLTGNMTFSER
YKQGTVPIVFDWAIRDGTCTPPSDGSDEAKPVVPSACISKHSSCANARNGPGYFCICDEG
YAGNPYTKDGCTNINECDHLISPNSTFRKKSYPCHGGTCQDVEGGYNCKCSFGRTGDGKS
DKGCEAIVSLAAIAAIGTISGISLLAVLLLFLHMDRQRRKLRDHFNRNGGQLLKSIKIEI
FTKEKLDQITKNYSHIIGRGNFGKVYKGTTSDNVQVAVKRSIAINEDRRKDLFANEITIQ
SQVSHKNLVQLLGCCLESEVPMLVYEFIPRGSLYDVLHGKDGTGRTHPLPLGARLDIAIY
SADGLAYMHSEASHKILHGDVKTGNILLDDEFVPKVSDFGTCRLMSIGKEHTNFVIGDSS
YIDPVYMKTGLLTEKSDVYSFGIVLLELITGKMARYDKNNSLPLNYIKAFKDGTTKQMLD
TDIASTDEDINCLEMVGRVAVKCLEVDVNDRPTMAQVMQELKMQKIQWLHSHDKIGDAEI
CTTSVSVYNSHLQNPEISVYKALLSSHPLSS
Download sequence
Identical sequences I1IWB8
XP_003581264.2.954 EG:BRADI5G03632.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]