SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G03960.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G03960.1
Domain Number 1 Region: 594-899
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-59
Family Protein kinases, catalytic subunit 0.00038
Further Details:      
 
Domain Number 2 Region: 40-333
Classification Level Classification E-value
Superfamily L domain-like 8.16e-59
Family Polygalacturonase inhibiting protein PGIP 0.0011
Further Details:      
 
Domain Number 3 Region: 273-519
Classification Level Classification E-value
Superfamily L domain-like 2.89e-47
Family Polygalacturonase inhibiting protein PGIP 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G03960.1   Gene: BRADI5G03960   Transcript: BRADI5G03960.1
Sequence length 912
Comment pep:novel chromosome:Brachy1.0:5:5069783:5072901:1 gene:BRADI5G03960 transcript:BRADI5G03960.1
Sequence
MDMAALCSLSPLVLLLLTNLLVFFSSNTIAQSKSNKYEIERQALLSFKSGVSNDPHEVLS
SWGGSLHFCRWNGVVCGMTRPFHVVSVDLSSSSLSGELSPWIANLTSLERVDLSENRFAG
VIPEELGTLQHLKYLMLPTNNLVGMVPRSLGTSRSLTEVNLAQNFLTGTIPDFHKMSVLQ
ILDLSSNELSGSVPLSLGNVSSLTAIWLESNNLSGPIPETLSLIQNISVLSLGSNSLSGH
VSAKLCNISSLIYLGLSENYLTGSIPSCIGNMLPKLENLSMSRNKFDGLIPPSLANASKL
QRIDLGYNSLVGPVPSLGSLSDLRLLILERNSLQAEGNKFSGQIPYTIGNLSVLTTLYLD
NNDLSGNIPTSLGKCKQLLMINLAINNLQGPIPSELINSTALVGLDLSTNYLTGSIPQEI
GTLLQLVRLDISYNKLSGEVPFSLGQCVQLSSLRLRSNMLNGSIPQSFSNLKSIDQVDLS
QNYLVGQIPEFFASMIFLQQLDLSTNYFEGPILTGGIFRNNSAAILHGNTHLCERATTTL
FQFPICSTPSADESKINALLLVKIIAPIAIALLSFICFVATLLKRRQAHIAPCYKETMKK
VSYGDIIKATNWLSPVNKISSSRTSSIFIGRFEFDTDLVAIKLFHLEENGARNSFLTECE
VLRNTRHRNIVKAVTVCSTVDLENNEFKAIVFDFMANGSLDMWVHPKLHQNSPKRLLTLG
QRLRIAADVALALDYMHNQLTPPLIHCDLKPGNVLLDYDMTARVGDVGSARFLSSSPGSP
EDLVGVEGTIGYIAPEYGMGYKVSTGCDVYGFGVLLLEMLTGRRPTDAMFTDGMSLHKLV
SSAFPGRLREVLDPHMAHEKQNVCEKVFMRSYMVPMVEVGLQCSMESPKDRPGMGEVCAK
ILPLKQAFFESC
Download sequence
Identical sequences I1IWG3
EG:BRADI5G03960.1 15368.BRADI5G03960.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]