SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G05662.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G05662.1
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.01e-40
Family C-terminal domain of ribosomal protein L2 0.0000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G05662.1   Gene: BRADI5G05662   Transcript: BRADI5G05662.1
Sequence length 147
Comment pep:novel chromosome:Brachy1.0:5:7218817:7219260:1 gene:BRADI5G05662 transcript:BRADI5G05662.1
Sequence
MHNIEITRGRGGQLARAAGAVAKLIAKEGKSATLRLPFGEVRLVSQNCLATVGQVGNVGV
NQKSLGRAGSKCWLGKRPIVRGVVMNPHGGGEGKAPIGRKKPTTPWGYPALGRRTRKRKR
RALKPNTLPTMEVNMLVTEPSSNRSNG
Download sequence
Identical sequences I1IWP8
EG:BRADI5G05662.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]