SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G07360.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G07360.2
Domain Number 1 Region: 560-728,765-889
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-82
Family Protein kinases, catalytic subunit 0.00000228
Further Details:      
 
Domain Number 2 Region: 124-216
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.56e-25
Family Flavin-binding PAS domain 0.0000506
Further Details:      
 
Domain Number 3 Region: 396-495
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.02e-23
Family Flavin-binding PAS domain 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G07360.2   Gene: BRADI5G07360   Transcript: BRADI5G07360.2
Sequence length 909
Comment pep:novel chromosome:Brachy1.0:5:9807063:9823126:-1 gene:BRADI5G07360 transcript:BRADI5G07360.2
Sequence
MAGAGSSKGMADAVEKWMAFPAGGEEETTGGFTLPMPPLSPPGGKEIVEEPGNQQQQQGW
WPKPAAEQRGSVSGKPAEPRGSGVGSSKPSMEGRASYDSLPRVSQELKDALSNLQQTFVV
SDATRPDCPIIYASAGFYTMTGYSAKEIIGRNCRFLQGAETDQKEVSKIRDAVKAGKSFC
GRLLNYRKDGTPFWNLLTVTPIRDDQGKVIKFIGMQVEVSKYTEGLSDKCMRPNEMPVSL
IRYDDRQRENAMSSMTEVVQTVKHRKADTPEMMMMETPKLSNADKDGGSRMAVAGSSPLV
TPATPSGGGLKSPLWDLKKEESRMSRLMSGRKSLMGFKVGKRSSVGSREPAVVQEAPEVK
MTVERTDSWERAEREKDIRQGIDLATTLERIEKNFVITDPRLPDNPIIFASDSFLELTEY
TREEILGRNCRFLQGAETDQTTVDKIRDAIREQKEVTVQLINYTKSGKKFWNLFHLQPMW
DQKGELQYFIGVQLDGSDHVEPLRNRLSETTEIQSAKLVKATAGNVDDAVRELPDANLRP
EDLWAIHSLSVSPKPHKRNNSSWKAIAKIVQTGEKIGLKHFKPVKPLGCGDTGSVHLVEL
QGSGELFAMKAMDKSVMLNRNKVHRAIIEREIYSLLDHPFLPTLYTSFQTPTHVCLITDF
CPGGELFAALDKQPLKIFREESARFYAAEVVIGLEYLHCLGIIYRDLKPENILLQADGHV
VLTDFDLSFLTSSKPHVIKHAASLKRRRSKEFLPPSFVADPSTPSNSFVGTEEYIAPEVI
SGAGHTSAIDWWALGILLYEMLYGRTPFRGKNRRKTFYNILHKDLTFPSSIPVSLAAKQL
IHGLLQRDPSSRIGSNTGANDIKEHPFFEDIYWPLIRCMSPPELHVPLKLIGKESQPKLN
PEEGVLDKF
Download sequence
Identical sequences I1IWY7
XP_003581132.1.954 XP_010239787.1.954 XP_010239788.1.954 XP_010239789.1.954 XP_014751394.1.954 15368.BRADI5G07360.3 EG:BRADI5G07360.1 EG:BRADI5G07360.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]