SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G09890.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G09890.1
Domain Number 1 Region: 55-150
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.33e-27
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G09890.1
Domain Number - Region: 260-299
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000373
Family Pan module (APPLE domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G09890.1   Gene: BRADI5G09890   Transcript: BRADI5G09890.1
Sequence length 452
Comment pep:novel chromosome:Brachy1.0:5:13181680:13184200:-1 gene:BRADI5G09890 transcript:BRADI5G09890.1
Sequence
MVHLILFVFATLFHLSIAATTDTISAGQPLGSGDKVVSRNGRYALGFFQTGGESNWYMGI
WFNTVPKLTPAWVANRVIPVKNTTLLQLVIFHDGNLVILDRSSNSVIWSTRANVKANNTI
AVLLDSGNLILQNSSNPSEILWQSFDYPTDTSLPGAKLGWDKVTGLNHRLVSWKNSVNPA
AEMSKHHLVNFTFVDNDQEKYFMYTLDDESMVRSPKDWELDDRAGGCSRNTLLNCIGNKS
TSSTDKFHSIACVKLPQNAQSMQIAASAGECAQVCQRDCSCTAYSFGDGGCSIWHNDLLN
IWQQQCSGISSIDGETLYVRLNADELHTQKPNRRGLIVGVIICASVTALGLLLVFLQLVI
WKNKTKFSAGGKLLEGESGSLVDHMLQDDVDLLEVQIACKVACWCIQDDEFNRPTMGRVV
QILEGLVDISVPPMPRLLQAMTGTGSSHLRCS
Download sequence
Identical sequences I1IXN7
EG:BRADI5G09890.1 15368.BRADI5G09890.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]