SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G09900.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G09900.1
Domain Number 1 Region: 489-797
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-76
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 64-159,191-224
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.5e-29
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G09900.1
Domain Number - Region: 355-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00118
Family Pan module (APPLE domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G09900.1   Gene: BRADI5G09900   Transcript: BRADI5G09900.1
Sequence length 826
Comment pep:novel chromosome:Brachy1.0:5:13186144:13188802:1 gene:BRADI5G09900 transcript:BRADI5G09900.1
Sequence
MQNLIVIVFSLLLCLLHIPASWAATETISAGQALAGNDRLISSNGKFALGFFRPSSKSSH
NASNWYLGIWFNQIPKCTPAWVANGDKPVAGSTSPELIISGDGNLVILDQATKLIIWSTQ
ANTTAKNTVAMLLKTGNLVLQNTSNSSHVLWQSFDYPTDTHLAGAKLGLDKVTGLNRRLV
SRKNSIDPAPGIYSYELHETKVSARFSLAAFNSSITYWSSGEWNGYYFGSIPEMTGRQLI
DFTFVNNQQEVYFTYTLLDDATIMRFALDVSGQAKIFLWVEHALDWVPAHTNPTNQCDVY
GICGPFATCKENKLPFCSCMEGFSVSSPDDWELGDRTGGCMRNTPLNCSINKSTSVQDRF
YPMPCVRLPNNGHKIGDATSAGGCAQVCLGNCTCTAYSYGNNGCLIWEDELTNVKQLQCD
DSGNNNQATLCLRLDAKEVQTLQKNRRRINVVVIGASVVSFGLLSLFLILIIRRLCAHRM
KKLQGGGGIIMFRYPDLQRATKNFSEKLGAGGFGSVFKGFLNDSSVVAVKRLDGALQGEK
QFRAEVRSIGIIQHINLVKLIGFCTEGDRKLIVYEHMHNRSLDNHLFHSNGTGLKWNIRY
QIAIGVARGLAYLHDSCRDCIIHCDIKPENILLDASFVPKIADFGMAKFLGRDFSRVLTT
MRGTIGYLAPEWISGTVITAKVDVYSYGMVLLEIVSGKRNSGRDCTSGDNYVYFPVQVAN
KLLEGDVETLVDKNLHGDFNLEQVERAFKVACWCIQDGEFDRPTMGEVVQYLEGFHEVEI
PPVPRLLQAIAGNPHSKSDWYLDRTSEEAEKLKDTRGSALHQGAHS
Download sequence
Identical sequences I1IXN8
EG:BRADI5G09900.1 XP_010239898.1.954 15368.BRADI5G09900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]