SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G10787.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G10787.1
Domain Number 1 Region: 458-771
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-70
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 99-327
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00000000000012
Family beta-lactamase inhibitor protein-II, BLIP-II 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G10787.1   Gene: BRADI5G10787   Transcript: BRADI5G10787.1
Sequence length 801
Comment pep:novel chromosome:Brachy1.0:5:14115987:14118616:-1 gene:BRADI5G10787 transcript:BRADI5G10787.1
Sequence
MSPKFPPSPLTFFFALVVLALPSLAAASSSFALPTIAIAAVGANTTSPHHLACGLVSTGT
DYHLSCASVSNRSASPHEYGHGEGRGGASTTPFSAVVAGDGYVCSVGPTSSNPESMRWWD
LADEEKPSKRVYRGAELSAVAGGGEYVCGLVETRIQCWRWPWAPLPKDVGFTAVALGGGF
VCGLVVGTGEVKCYGDGDAVGREPRGRYMLLAAGERHACAVDDAGMLDCWGEAAAVAAAA
PPRLVRSVSTVAVGDGVTCVLWGNWTASCWPEAEAAPPQAMAQRQFVALEAKGKVVCGVL
MSDYSMVCWGGDVAGGLSKVFDKVLPGPCAPSGSCPCGVWSGSAALCGDSTGYGAAICYP
CGYTPPMMLQVPSTSQSTGKKQRPISDLAIALICVGIGSGLGTLLAALSVAYCLRQRSGS
GRSSSHGSGRIHAEPTSATIPAPPRVPRRLSALLSKGPNTTVEQFPLAALRAATGVFSPS
HRIGSGSFGAVYRASLPDGREVAIKRAERRDTGGASSSAAAAAARRVNHESAFVSELSLL
SRLNHKNLVRLLGFCADGGEHILVYEFMPNGTLHDHLHKRPAPLSPPLASWPARLRLALG
AARGIEYLHTYAVPPIIHRDIKSSNILLDATWSAKVADFGLSLLNNSSNAGDNNEPLVTA
GTVGYMDPEYYRLQHLTDKSDVYSFGVLLLELLSGCKVIQRYEGSGTPRNVVDMAVPYIE
SDRVHRVLDIRLPLPTPGEMEAVAYVGYLAADCVRLPGRDRPSMSEAVGVLERAVAACED
DEDGADEAALSRSCTDGSATM
Download sequence
Identical sequences I1IXZ8
XP_003581257.1.954 EG:BRADI5G10787.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]