SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G12510.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G12510.2
Domain Number 1 Region: 8-241
Classification Level Classification E-value
Superfamily 14-3-3 protein 1.83e-106
Family 14-3-3 protein 0.00000000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G12510.2   Gene: BRADI5G12510   Transcript: BRADI5G12510.2
Sequence length 262
Comment pep:novel chromosome:Brachy1.0:5:15961941:15964040:1 gene:BRADI5G12510 transcript:BRADI5G12510.2
Sequence
MSAPAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVI
GARRASWRIISSIEQKEESRGNEDRVTLIKDYRGKIETELTKICDGILKLLETHLVPSST
APESKVFYLKMKGDYYRYLAEFKSGAERKDAAENTMVAYKAAQDIALAELAPTHPIRLGL
ALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTS
DITEDTAEEIREAPKGDSGDGQ
Download sequence
Identical sequences I1IYI7
15368.BRADI5G12510.3 XP_003579911.1.954 EG:BRADI5G12510.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]