SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G14137.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G14137.1
Domain Number 1 Region: 301-629
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.57e-50
Family Ankyrin repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 91-343
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.84e-20
Family Ankyrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G14137.1
Domain Number - Region: 697-759
Classification Level Classification E-value
Superfamily PH domain-like 0.0193
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G14137.1   Gene: BRADI5G14137   Transcript: BRADI5G14137.1
Sequence length 768
Comment pep:novel chromosome:Brachy1.0:5:17611018:17617692:1 gene:BRADI5G14137 transcript:BRADI5G14137.1
Sequence
MAVLLRPAAIAGGRQVWPVAEEAGEADASQRLVEAVARGDAREAGELLASGRADVNYAGV
VWLDARRVAEAALREGAAAELRASREEIRADVSPLFLAAGNGDVALVRALLAKGADVNGK
VFRGYPTTAAAREGRAEVAELLVRAGASQPACEEAIVEAALQGQAALAAIFMCSDLVRPR
VAVHALVSAAARGFVDVVDTLVECGADTNTTSRVLLRSLKPSLHLNVDCTALFAAIVSRQ
VAVVRQLLQIGVKKDSKVRLGAWSWDAATGEELRVGAGLAEPYDVAWCAVEYYESTGSIL
RLLLQNGYSSGATHLGRTLLHHAILCGSVGAVETLLAAGVDCEAPVKTSRSTRSRPVHMA
ARLGQPEILQMLMDMGCDVNARGEAGDVAVILASRHKREDCLRVLVSAGADLALLNSAGE
SAASVASSAGWKTGFERAVLAAIRSGIVPLSSDPNVFSPMMFAASCGDAASFEVLMAQPD
VDVDEQDADGCSPMMVAAMEGNVDAFRALVFAGANVKLSNKRGETAIGLAQLSKKRDLFE
QVMLEFALEKGMPAGGFYALHCASRRGDAAAVHHLASTGYDVNIPDGDGYTPLMLAAREG
HAAVCELLISHGARCDIKTTRGETALSMARAALATAPFNKAEDVIMDELGRQLVLQGAHV
AKHTKGGRGRPHGKSLRMVAAIGVLRWGGSSRRNVMCKEAEVGGSSAFQRHRQRKGRGND
AYTPGLFRVVTTTGKEFHFVCQGGEEEAELWVRGIRALTRAVFGKRGN
Download sequence
Identical sequences I1IZ44
EG:BRADI5G14137.1 XP_003580025.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]