SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G15070.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G15070.1
Domain Number 1 Region: 787-1077
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-75
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 319-692
Classification Level Classification E-value
Superfamily RNI-like 2.04e-67
Family Cyclin A/CDK2-associated p19, Skp2 0.052
Further Details:      
 
Domain Number 3 Region: 44-399
Classification Level Classification E-value
Superfamily L domain-like 2.04e-64
Family Polygalacturonase inhibiting protein PGIP 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G15070.1   Gene: BRADI5G15070   Transcript: BRADI5G15070.1
Sequence length 1103
Comment pep:novel chromosome:Brachy1.0:5:18454647:18458186:-1 gene:BRADI5G15070 transcript:BRADI5G15070.1
Sequence
MGPGTASASWGLQLGVVLVFLLASGSQGLNHEGWLLLALKSQMIDSSHHLDNWKPRDPSP
CMWTGVICSSAPMPAVVSLNLSNMELSGTVGQSIGGLAELTDLDLSFNEFFGTIPTGIGN
CSKLVWLALNNNNFEGTIPPELGKLAMLTTCNLCNNKLYGSIPDEIGNMASLVDLVGYSN
NISGSIPHSIGKLKNLQSIRLGQNLISGNIPVEIGECHNLVVFGLAQNKLQGPLPKEIGN
LSLMTDLILWGNQLSGAIPPEIGNCTNLRTIALYDNGLVGPIPPTIGNIKYLQRLYLYRN
SLNGTIPPEIGNLLLAGEIDFSENFLMGGIPKELGNIPGLYLLYLFQNQLTGFIPKELCG
LKNLTKLDLSINSLTGPIPAGFQYMPKLIQLQLFNNRLSGDIPPRFGIYSRLWVVDFSNN
NITGQIPRDLCRQSNLILLNLMSNKLSGNIPHRITSCRSLVQLRLSDNSLTGSFPTDLCN
LVNLTTIELARNKFNGPIPPQIGNCMALQRLDLTNNYFTSELPREIGNLSKLVVFNISSN
RLGGSIPLEIFNCTMLQRLDLSQNSLEGSLPTEVGRLPQLELLSFADNRLSGQVPPILGK
LSHLTALQIGGNQFSGGIPKELGLLSSLQIAMNLSYNNLSGNIPSELGSLALLENLFLNN
NKLTGAIPDTFANLSSLLELNVSYNNLTGALPPVPLFDNMVVTSFIGNRGLCGGQLGKCG
SESPSSSQSSNSVSRPMGKIIAIVAAIIGGISLILIAILLHQMRKPRETIAPLQDKQILS
AGSNMPVSAKDAYTFQELVSATNNFDESCVIGRGACGTVYRAILKPGHIIAVKKLASNRE
GSNTDNSFRAEILTLGKIRHRNIVKLYGFIYHQGSNLLLYEYMSRGSLGELLHGQSSSSL
DWDTRFMIALGAAEGLSYLHHDCKPRIIHRDIKSNNILLDENFEAHVGDFGLAKVIDMPY
SKSMSAIAGSYGYIAPEYAYTMKVTEKCDIYSYGVVLLELLTGRAPVQPIELGGDLVTWA
KNYIRDNSVGPGILDRNLDLEDKAAVDHMIEVLKIALLCSNLSPYDRPPMRHVIVMLSES
KDRAQTSSASSPASDNSSKKDSS
Download sequence
Identical sequences I1IZF9
EG:BRADI5G15070.1 15368.BRADI5G15070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]