SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G15977.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI5G15977.1
Domain Number - Region: 14-63
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000152
Family Hermes transposase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G15977.1   Gene: BRADI5G15977   Transcript: BRADI5G15977.1
Sequence length 93
Comment pep:novel chromosome:Brachy1.0:5:19404676:19404957:-1 gene:BRADI5G15977 transcript:BRADI5G15977.1
Sequence
MSAMEIFELVREEECYPNVSVAYRILFTMPVTVASAERSFSKLKLLKNYLRSTMSQERLN
GLATLCIEKKLVDEIDTHSIIDDFASRNVRRKF
Download sequence
Identical sequences I1IZR8
EG:BRADI5G15977.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]