SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G16600.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G16600.1
Domain Number 1 Region: 333-640
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-79
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 31-289
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-73
Family Legume lectins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G16600.1   Gene: BRADI5G16600   Transcript: BRADI5G16600.1
Sequence length 681
Comment pep:novel chromosome:Brachy1.0:5:19928581:19930826:1 gene:BRADI5G16600 transcript:BRADI5G16600.1
Sequence
MCPSRSFLLPILLLALLAGDGSDHAAVLAADQFTYNDFSGANLTLDGLAAVAPNGLLALS
NGTSQAAGHAFHPTPVRMRNNNGAAQSFSVAFVFAIVSNFTVLSDNGMAFVVAPSTRLST
FNAGQYLGILNVTDNGKAENGVFAVELDTMLNPEFQDMNSNHVGVDVNSMRSVQNHSAGY
YDDATGVFSNLSLISRQPMQVWVDYDGATTRLDVTMAPLDVPRPRKPLISAPVNLSAVLV
TDTAYVGFSAATGVIFTRHYVLGWSFALNGPAPPLDTSKLPALPRFGPKPRSKVLEIVLP
IATAAFVLALAIAFFLFVRTRVRYAEVREDWEVEFGPHRFSYKELYKATKGFKNKQLLGT
GGFGRVYKGVLPKPNLEIAVKRVSHDSKQGMKEFIAEVVSLGHLRHRNLVQLLGYCRRQG
ELLLVYDCMPNGSLDKYLYDKTKPVLDWGQRFQIIRGVASGLLYLHEDWEKIVIHRDVKA
SNVLLDGDMNGRLGDFGLARLYDHGLDPQTTHVVGTMGYLAPELVRTGKATPVTDVFAFG
VFVLEVACGRRPLGCAAPDEQNVLLDWVQEHQRRHAALDTVDPRLCGKYDADEARLAIKL
GLMCAHPLPDARPRMRQATQYLEGEVPMPDLVPTFLSYTTLALMQNDGFDSFAMSFPSTV
STSVSPISGDVSAVSGLSGGR
Download sequence
Identical sequences I1IZZ9
15368.BRADI5G16600.1 XP_003580202.1.954 EG:BRADI5G16600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]