SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G18250.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G18250.2
Domain Number 1 Region: 96-374
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-83
Family Protein kinases, catalytic subunit 0.00000219
Further Details:      
 
Domain Number 2 Region: 395-536
Classification Level Classification E-value
Superfamily EF-hand 8.31e-49
Family Calmodulin-like 0.0000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G18250.2   Gene: BRADI5G18250   Transcript: BRADI5G18250.2
Sequence length 541
Comment pep:novel chromosome:Brachy1.0:5:21294086:21296831:-1 gene:BRADI5G18250 transcript:BRADI5G18250.2
Sequence
MGNCCAKTYEMEIPITSGTMERPPTFGNHPPPPAAGQRSKGQDRPPTSWRLPTFPKQAPP
PSGRPALPSSLTGVSQSRKAGGAMGPVLQRPMVDVRSQYNLERKLGSGQFGTTYLCTERA
TGLKYACKSVSKRKLLRRADVEDIRREVTILQHLSGQPNIAEFRGAFEDGESVHLVMEFC
SGGELFDRITAKGSYSERQAAAVCRDVLTVVHVCHFMGVMHRDLKPENFLLASPAEDAPL
KAIDFGLSVFIEEGKVYKDIVGSAYYVAPEVLRRNYGREIDVWSAGVILYILLCGSPPFW
AETEKGIFDAILVAQLDFSSSPWPTISENAKDLIRQMLNTDRQKRITAAQALEHPWLKEG
GASDRPIDSAVLLRMKQFKAMNKLKQLALKVMAENLSPEEIKGLKQMFNNMDTDKSGTIT
VEELKIGLTKLGSKISEAEVQKLLEAVDVDKSGSIDYTEFLTAMMNKHKMEKEEDLIRAF
QHFDKDNSGYISREELKQAMTEYGIGDEANIKEVLDEVDKDKDGRIDYEEFVEMMRKGIY
T
Download sequence
Identical sequences I1J0J5
XP_010240253.1.954 EG:BRADI5G18250.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]