SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G18300.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G18300.2
Domain Number 1 Region: 283-310,349-435
Classification Level Classification E-value
Superfamily Pseudouridine synthase 7.91e-16
Family Pseudouridine synthase II TruB 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G18300.2   Gene: BRADI5G18300   Transcript: BRADI5G18300.2
Sequence length 440
Comment pep:novel chromosome:Brachy1.0:5:21321448:21326118:-1 gene:BRADI5G18300 transcript:BRADI5G18300.2
Sequence
MEVQQGRSMSLTTDSTCCRLHMKEKYGNENWFKDKIFSQQTMSVKEALRLLLVPSLEKKL
DVKHGNNSFRIRLTYTHDDASRKLKSLLPNDRNRKRKTESREGTDTRRNSTYEDNQILSE
TDSFIHKTLECIQDQEFCSLFQLPPEKVFKPCHLVISCLRSPIYIGGRYLKLSRNVSQSC
WIIDDERMGEASVEEIIGEDVRTICRGDGCKFHAAGREDIDVRMLGSGRPFLIEVLNARS
IPSAIEVEQIAEKINSSEKKYVRVRNLKLVDREIWSMMREGEAEKQKQYAALIWTSRSLT
DVDLQKISGVNDMAAGNKPVKIRYELSLDFLLSSVPGLMFFLSTSMHLFRQEIVQNTPIR
VLHRRSPLERKRIIHWMEIEKVEGSSNYYLLHLCTQAGTYIKEFVHGDLGRTHPSIGAIL
GCRAEILQLDVTDVKMDLLQ
Download sequence
Identical sequences I1J0K3
EG:BRADI5G18300.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]