SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G19367.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G19367.2
Domain Number 1 Region: 224-606
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.88e-86
Family Regulator of chromosome condensation RCC1 0.00065
Further Details:      
 
Domain Number 2 Region: 610-674
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000456
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 14-94
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000307
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G19367.2   Gene: BRADI5G19367   Transcript: BRADI5G19367.2
Sequence length 1023
Comment pep:novel chromosome:Brachy1.0:5:22377222:22382396:1 gene:BRADI5G19367 transcript:BRADI5G19367.2
Sequence
MAGSFDGRTPTRGVEQAIVALKKGAHLLKCGKRGKPKFCPFRLSSDEKTLVWYSKDREKH
LSLNSVSTVILGQKTICRDRDQAECWHLGLTALISAHSPFSSVGSKSGRQITSCTNTPRS
YIQRKSKLSAVHDTPRHKQVYPSYGSPKMTPKDFFGSYLDCSEALFYQRQQTFSDVDSYL
EKLNPKVTNPARHGLKDILVGNKHKTQITQKPNLKTFEVPRAACRLDSLNDVFLWGDVLG
SMLDSEDIPKALPRLVASTTMLDVQSIACGENHAAIVTKLGEVFSWGNESSRTLGHQIND
SVSCPKLVEALASVHVKAVAFGSKHTCAVTVSGELLEWSEGAHRLGLLSNWYERNQWSPH
KLFGPMDSISVSKIACGEWHTAIITSSGQLFTYGDGTFGVLGHGDKQGIARPKEVESLKG
LRVKSVACGPWHTAAVVEVTSSFNCNAPSGKLFTWGDADRGKLGHADKKIKLVPTCVDLL
TSYDFLQVSCGAALTVVLTSTGVVFTIGSSKHGQLGNPHADGESICTVEGTLKNEFVREI
SSGSSHVAVLTLKGQVFTWGKGADGQLGLGDYDNRSSPTLVEALQGRHVQSIACGSNFSA
AVCLHKGMSVKDQSICSGCQMAFGFTRKKHSCYNCGSMFCNSCSSNKIAKADKNRRYRVC
DVCFCQLQKVVDSSKFKPQPKISKGDMFRAEIKAYTPKLSRLFKEANLIVEKMAAVQGPN
QKNVDSAIPIQEKTRRWGQVECPGQFVSARENFKHQPISNNQMHSVSFSQRMHDSVGLKV
GNSLRRSTDSQKEELTMTETMLKEEVKQLRSQVTALGEQCQQKNLIAQLYKQRLDETWLL
VRDEAAKCKAAKDIIKVLTNQCNALSEKLSVGQQSGNSKITPNSVPRRAPSTDVVVPADG
SFSHHNIARTFDSDGYTTESNSTAAPIDGHQNIARKSDGSGYTTEADSTSAPIDGVIEQI
ERGVYATLAVSPSGQKDIRRMRFSRKHFSEKQAQRWWEENMSKVYEKYSTKKAATPSLNC
HLR
Download sequence
Identical sequences I1J0Y5
EG:BRADI5G19367.2 EG:BRADI5G19367.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]