SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G21840.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI5G21840.2
Domain Number - Region: 51-123
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0034
Family Myosin rod fragments 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G21840.2   Gene: BRADI5G21840   Transcript: BRADI5G21840.2
Sequence length 282
Comment pep:novel chromosome:Brachy1.0:5:24354414:24356802:-1 gene:BRADI5G21840 transcript:BRADI5G21840.2
Sequence
MARHEAAARVEFDLPDEILAVIPTDPYEQLDIARKITSMAIASRVSRLEADVARLRRDLA
DRDRSEADLRARLADSDSRLLAALDENAKLVKERDTLAVTAKKLSRNLAKLEAFKKQLMK
SLSEDNLLQLSETGEDRDVDAESNWTARTPSWKDEVSSSRASSNTSSRSTITESAQGHQF
SLTPYVAPRITPGSTPIISSSVGSPLAYSTGPSSPKFLSGPTSPTRSLSESQSTFSSWNG
SSLHQYSAPTSPPQRRSFTGRPRIDGKEFFRQARLVPNFLYC
Download sequence
Identical sequences I1J1U6
EG:BRADI5G21840.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]