SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G21960.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G21960.1
Domain Number 1 Region: 340-732
Classification Level Classification E-value
Superfamily RNI-like 8.63e-66
Family Cyclin A/CDK2-associated p19, Skp2 0.062
Further Details:      
 
Domain Number 2 Region: 100-420
Classification Level Classification E-value
Superfamily RNI-like 3.61e-65
Family Cyclin A/CDK2-associated p19, Skp2 0.061
Further Details:      
 
Domain Number 3 Region: 880-1207
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-59
Family Protein kinases, catalytic subunit 0.00038
Further Details:      
 
Domain Number 4 Region: 723-790
Classification Level Classification E-value
Superfamily L domain-like 0.00000000873
Family Polygalacturonase inhibiting protein PGIP 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G21960.1   Gene: BRADI5G21960   Transcript: BRADI5G21960.1
Sequence length 1223
Comment pep:novel chromosome:Brachy1.0:5:24444847:24448604:-1 gene:BRADI5G21960 transcript:BRADI5G21960.1
Sequence
MVPPKKTRDASVLPLHVLAFLALAALLGSSPRAAAASASVQLEALLEFKKGVTADPLGAL
SGWQKKADSRNAIAAAAIVPPPHCNWTGIACNIAGQVTSIQLLESQLEGTLTPFLGNITT
LQVLDLTSNAFFGLIPPELGRLQSLEGLILTVNTFTGVIPTSLGALTSLQILDLSNNSLH
GTIPSQLCNCSAMWALGLEANNLTGQIPPCIGDLSNLEIFQAYINSLSGELPRSFANLTK
LTTLDLSGNQLSGRVPPAIGTFSGLKILQLFENRFSGKIPPELGNCKNLTLLNIYSNRFT
GAIPRELGGLTNLKALRVYDNALSSTIPSSLRRCSSLLALGLSMNELTGNIPPELGELRS
LQSLTLHENRLTGTVPKSLTRLVNLMRLSFSDNSLSGPLPEAIGSLRNLQVLIIHGNSLS
GPIPASIVNCTSLSNASMAFNGFSGSLPAGLGRLQSLVFLSLGDNSLEGTIPEDLFDCVR
LRTLNLAENNLTGRLSPRVGKLGGELRLLQLQGNALSGSIPDEIGNLTRLIGLTLGRNKF
SGRVPGSISNLSSSLQVLDLLQNRLSGALPEELFELTSLTVLTLASNRFTGPIPNAVSKL
RALSLLDLSHNMLNGTVPAGLSGGHEQLLKLDLSHNRLSGAIPGAAMSGATGLQMYLNLS
HNAFTGTIPREIGGLAMVQAIDLSNNELSGGVPATLAGCKNLYTLDISSNSLTGELPAGL
FPQLDLLTTLNVSGNDFHGEILPGLAGMKHLQTVDVSRNAFEGRVPPGMEKMTSLRELNL
SWNRFEGPVPDRGVFADIGMSSLQGNAGLCGWKKLLAPCHAAAGNQRWFSRTGLVTLVVL
LVFALLLLVLVVAILVFGHRRYRKKKGIESGGHVSSETAFVVPELRRFTYGELDTATASF
AESNVIGSSSLSTVYKGVLVDGKAVAVKRLNLEQFPAMSDKSFLTELATLSRLRHKNLAR
VVGYAWEREAAGNGNGNRMMKALVLEYMDNGDLDAAIHGGGRGALDAHTAPPRWATVAER
LRVCVSVAHGLVYLHSGYGGSPVVHCDVKPSNVLMDADWEAHVSDFGTARMLGVQLTDAP
AQETGTSSAFRGTVGYMAPELAYMRSVSPKADVFSFGVLVMELLTKRRPTGTIEDDGSGV
PVTLQQLVGNAVSMGIEAVAGVLDADMSKAATDADLCAAAGALRVACSCAAFEPADRPDM
NGALSALLKISNACGPGKTRIDH
Download sequence
Identical sequences I1J1W4
15368.BRADI5G21960.1 XP_010227269.1.954 EG:BRADI5G21960.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]