SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G22620.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G22620.1
Domain Number 1 Region: 786-1090
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-69
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 356-712
Classification Level Classification E-value
Superfamily RNI-like 7.38e-62
Family Cyclin A/CDK2-associated p19, Skp2 0.023
Further Details:      
 
Domain Number 3 Region: 41-319
Classification Level Classification E-value
Superfamily L domain-like 5.78e-56
Family Polygalacturonase inhibiting protein PGIP 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G22620.1   Gene: BRADI5G22620   Transcript: BRADI5G22620.1
Sequence length 1117
Comment pep:novel chromosome:Brachy1.0:5:24926539:24930035:-1 gene:BRADI5G22620 transcript:BRADI5G22620.1
Sequence
MAASCIYVLVLLVLPGISVFAVVPGAASSSSPSPTNANSSDTDLATLLAFKSHLSDPQGV
LASNWTTGTSFCHWIGVSCSRRRQRVTALELPGLPLHGSLAPHLGNLSFLSIINLTNTIL
KGSIPDELGRLRRLKFLDLGRNGLSGSIPPAIGNLTRLQVLVLKSNQLSGSIPEELHNLH
NLGSINLQTNYLSGSIPIFLFNNTPMLTYLTIGNNSLSGQVPYSIALLPMLEFLDLQYNH
LSGLFPPAIFNMSKLHTIFLSRNYNLTGSIPDNGSFSLPMLQIISMGWNKFTGQIPLGLA
TCQHLTVISMPVNLFEGVVPTWLGQLTHLYFISLGGNNLVGPIPAALCNLTSLSVLSLPW
SKLTGPIPGKIGQLSRLTFLHLGDNQLTGPIPASIGNLSELSLLVLDRNMLAGSLPGTIG
NMNSLVKLSFFENRLQGDLSLLSILSNCRKLWYLDMSSNNFTGGLPDYVGNLSSKLETFL
ASESNLFGELPATVSNLTSLRVLDLSKNQLYGEIPASIMMMENLQSLSLRWNSLSGPIPS
QTAMLKNLVKFHLGHNKLSGSIPEDIGNHTMLEEIRLSYNQLSSTIPPSLFHLDSLLRLD
LSQNFLSGALPVDIGYLKQIYFLDLSANRLTSSLPDSVGKLIMITYLNVSCNSLYNPISN
SFDKLASLQILDLSQNNLSGPIPKYLANLTFLYRLNLSFNNLHGQIPEGGVFSNISLQSL
MGNSGLCGASSLGFPSCLGNSPRTNSHMLKYLLPSMIVAIGVVASYIFVIIIKKKVSKQQ
GMKASAVDIINHQLISYHELTHATDNFSESNLLGSGSFGKVFKGQLSNGLVIAVKVLDMQ
LEHAIRSFDVECRVLRMARHRNLIRILNTCSNLEFRALVLQYMPNGNLETLLHYSQSRRH
LGLLERLDIMLGVAMALSYLHHEHHEVILHCDLKPSNVLFDKDMTAHVADFGIARLLLGD
ESSVISTSMPGTAGYMAPAEYGSLGKASRKSDVFSYGIMLLEVFTGRRPTDAMFVAGLSL
RQWVHQAFPAELAQVVDNQLLPQLQGSSPSICSGSGDDVFLVPVFELGLLCSRDSPDQRM
TMSDVVVRLERIKREYVECAAETWGSDTAKFGADPDV
Download sequence
Identical sequences I1J247
EG:BRADI5G22620.1 15368.BRADI5G22620.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]