SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G22760.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI5G22760.1
Domain Number - Region: 36-113
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.0123
Family DmpA-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G22760.1   Gene: BRADI5G22760   Transcript: BRADI5G22760.1
Sequence length 151
Comment pep:novel chromosome:Brachy1.0:5:24997567:24998022:-1 gene:BRADI5G22760 transcript:BRADI5G22760.1
Sequence
MELDLDTSRGHPLTLQEVGGILTVVAVGGTVFYFLKGVGRSPKGRRLAGGARAVVANTPR
VARWAGWWGAMWAIEIAMDHACGADGPWNAWSPVAARFRAALKGATLAAVAEKTLYGLKA
CSACWKLMAHAMRNFWAMKFNQLDPIISSFS
Download sequence
Identical sequences I1J262
15368.BRADI5G22760.1 XP_010227289.1.954 EG:BRADI5G22760.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]