SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G22930.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G22930.1
Domain Number 1 Region: 466-773
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-83
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 57-150,182-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-26
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G22930.1
Domain Number - Region: 343-379
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00432
Family Hairpin loop containing domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G22930.1   Gene: BRADI5G22930   Transcript: BRADI5G22930.1
Sequence length 799
Comment pep:novel chromosome:Brachy1.0:5:25107287:25110485:-1 gene:BRADI5G22930 transcript:BRADI5G22930.1
Sequence
MDITPLPVFFLLSLICFCKSDDRITPAKPLSPGDKLISQGGIFALGFFSLTNSTADLYIG
IWYNKIPELTYVWVANRDNPITSTSPGNLVLTDNSDLVLSDSKGRSLWTAMNNITSGTVG
TAAILLDSGNLVVRLPNGTDIWQSFQHPTDTILPNMPLPLSKIDDLYTRLIAWRGPNDPA
TSDYSMGGDSSSDLQVVIWNGTRPYWRRAAWDGALVTALYQSSTGFIMTQTIVDRGGEFY
MTFTVSDGSPSMRMMLDYTGMFKFLAWNNNSLSWEVFIERPSPRCERYAFCGPFGYCDAT
ETVPICNCLSGFEPDGVNFSRGCMRKEDLKCGNGDSFLTLRGMKTPDKFLYVRNRSFDQC
AAECSRNCLCTAYAYANLKNGSTTVEQSRCLIWTGELVDTAKFHDGSGENLYLRLPSSTV
DKESNVLKIVLPVFLSGKWRIKEIQNKHTRQHSKDSKSSELENADIELPPICFKDIVTAT
DNFSDYNLLGKGGFGKVYKGLLGDGKEVAVKRLSKGSGQGANEFRNEVVLIAKLQHRNLV
RLIGYCTHEDEKLLVYEYLPNKSLDAFLFDATRNFVLDWPTRFKVIKGIARGLLYLHQDS
RLTIIHRDLKPSNILLDAQMNPKISDFGMARIFGGNEQQANTIRVVGTYGYMSPEYAMEG
SFSVKSDTYSFGVLLLEIVSGLKISSSHLIMDFPSLIAYAWSLWKDGNARELVDSSILEN
CPLHGVLRCIHIGLLCVQDHPNARPLMSSTVFMLENETAQLPTPKEPVYFRQRNYETEDQ
RDNLGISVNNMTITIPEGR
Download sequence
Identical sequences I1J282
15368.BRADI5G22930.1 EG:BRADI5G22930.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]