SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G23020.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G23020.1
Domain Number 1 Region: 478-516,551-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.15e-66
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 54-154,186-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.02e-24
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G23020.1
Domain Number - Region: 338-382
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00785
Family Hairpin loop containing domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G23020.1   Gene: BRADI5G23020   Transcript: BRADI5G23020.1
Sequence length 807
Comment pep:novel chromosome:Brachy1.0:5:25151480:25156549:-1 gene:BRADI5G23020 transcript:BRADI5G23020.1
Sequence
MSYFPVFILLFLFSSCKSDDQLTQAKPLSPGNMLVSKEGTFALGFFSPANSNRNLYVGIW
YNNIPERNRNILWVANRDKPATTTSSAMTTLMVSNSSNLVLLDLKGQTLWMTKNNMSAAQ
GLGGAYAVLLDTGNFVLRLPNGTIIWQSFDDPTDTALPGMRFLLSNKAHAVGRLVAWKGP
NDPSPGEFSFSVDPSSNLEIITWNGTKPYCRIIVWNGVSVSGGTYLRNTSSVMYRTIINT
GDMFYMMFTVSDGSPYTRVTLDYTGAFRILTWSNYSSSWTTISEKPSGSYGVYGSCGPFG
YADFTGAVPTCQCLDGFKHDGLNSCQRVEELKCGKRSHFVALPGMRVPGKFLHIQNISFE
QCAGECNRNCSCTAYAYANLSNAGTLADQTRCLVWTGELVDTWKTTFNGENLYIRLAGSP
VHEKSSLAKTVLPIIACLLILCIAVVLRCKNRGKNKKILKKLMLGYLSPSSELGGENVEF
PFLSFKDIISATHNFSDSCMLGRGGFGKVYKMQPMLWLNPVQSSTVGLPISGDGLTTNSK
SPMEVPPGILGDREVAIKRLSNGSGQGTEEFGNEVVLIAKLQHRNLVRLLGCCIHEDEKL
LVYEYMPNRSLDAFLFGVARGLLYLHQDSRLTIIHRDLKASNILLDKEMSPKISDFGMAR
IFGGNQQQGNTIRVVGTYGYMSPEYVMSGAFSVKSDTYSFGVLLLEIAWKLWEDGIAREL
VDSSVLDSCPLHEVLRCIHVGLLCVQDHSDARPLMSSVVFMLENETTFLPEPEQPAYFSP
RNHENAHARETMENSFNAMSITTLVGR
Download sequence
Identical sequences I1J291
EG:BRADI5G23020.1 15368.BRADI5G23020.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]