SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G23040.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G23040.1
Domain Number 1 Region: 460-665
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-35
Family Protein kinases, catalytic subunit 0.0025
Further Details:      
 
Domain Number 2 Region: 81-189
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-26
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G23040.1
Domain Number - Region: 352-394
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000667
Family Hairpin loop containing domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G23040.1   Gene: BRADI5G23040   Transcript: BRADI5G23040.1
Sequence length 694
Comment pep:novel chromosome:Brachy1.0:5:25163416:25167349:1 gene:BRADI5G23040 transcript:BRADI5G23040.1
Sequence
MHTKKIQDSLMATSCIRIFILLLSSSFCKSSDQLTHTKPLFPSDELISKGGDFALGFFSP
ASSNSSLHLGIWYNNIPERTYVWVANRDNPITAAPSTALAITNSSDMVLLDPNGHSVWTT
MSNSIARGAGAYAVLLDSGNFVLQLPNGTETWQSFDHPTDTILPTMRFVLSYKDKAVGRL
VSWKSPDNPSSGDFSYSSDPSAPTLQAFAWHGIRPYYRNGVANDASVISAGKYLPNRSSM
LFETEAELRDEFYFVFTVSPGSPFMHMTLDYKGWFKLLVWNTHSSSWTSFYERPTNTFDL
YASCGPYGYSDFTVAPMACRCLDGFEPNGLNFSRGCRRIEELECDKQSQFVTLREMRVPD
KFLHIMNRSFDECTAECSNNCSCTAYAYANLSKIGAMGDSSRCLVWSGELIDVAKLRGGE
PLYLRLAGSHGKRLKKEIQKKMVLGYFSTSNELKGENTEFPFISFEDILSATNMFADSNL
LGQGGFGKVYKGTLEDGNEVAVKRLSKGSGQGTLEYKNEVVLIAKLQHKNLVRLLGCCIH
EDENGYMSPEYVTRGAFSIKSDTYSFGVVLLEIVSGLKISSPQLIPNFCSLITYAWRSWE
DGKATELVDSSFVDSCPLHEVLRCINVGLLCVQDHPDDRPLMSSVMVTLENENTVLPTPK
QPVYFALCNCEGGEARGGMENSANPMSITTLDGR
Download sequence
Identical sequences I1J293
15368.BRADI5G23040.1 EG:BRADI5G23040.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]