SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G23060.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G23060.1
Domain Number 1 Region: 484-782
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-78
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 72-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.05e-23
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G23060.1
Domain Number - Region: 342-385
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0137
Family Anti-platelet protein 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G23060.1   Gene: BRADI5G23060   Transcript: BRADI5G23060.1
Sequence length 817
Comment pep:novel chromosome:Brachy1.0:5:25173506:25179492:-1 gene:BRADI5G23060 transcript:BRADI5G23060.1
Sequence
MAMHYTPIFFLLFLSSFCKSDDQLTRTKPLTHDDILISKGGDFALGFFSPTSSNKSFYLG
IWYHSIPGPRTIVWVANRDKPITTPSSAVLTITNGSQMVLSDSKGHNIWTTTNNIVAGGP
EAFAVLLDSGNFVVRLSNAKDQMWQSFDHPTDTILPNMRVLVSYKGQVAVSLVAWKGPDD
PSSGDFSCGGDPSSPTLQRMIWNGTRPYCRSNVLNGVSVTGGVHLSNASSVLFETSLSLG
DGFYYMFTVSGGLTFARLTLDYTGMFRSLNWNPHLSSWTVISESPKAACDLYASCGPFSY
CDLTGTVPACQCLDGFEPSDLKFSRGCRRKEELKCDKQSYFVTLPWMRIPDKFWHVKKIS
FNECAAECSSNCSCIAYAYANLSSVGAMADSSRCLIWTGELVDIGKFSMNYGENLYLRLA
NTPADKRSSTIKIVLPIVACLLLLTCIALVWICKHRGKMRKKETQKKMMLEYFSTSNELE
GENTEFSFISFEDILSATNMFADSNLLGRGGFGKVYKGTLECGNEVAVKRLSKGSGQGTL
EFRNEVVLIAKLQHKNLVRLLGCCIHQDEKLLIYEYLPNKSLDVFLFDVARKYELDWSTR
FKIIKGIARGLLYLHQDLRLTIIHRDLKPSNILLDKEMIPKISDFGMAKIFGANQNQANT
IRVVGTYGYMSPEYVIGGACSTKSDTYSFGVLLLEIVSGLKISSPQLIPTFSSLITYAWR
LWEDGKATELVDSSFVDSCPLHEVLRCIQVGLLCVQDRPDDRPLMSLVIVTLENESVVLP
APKQPVYFDLRNCDGGEARESMVNSANPMSITTLEGR
Download sequence
Identical sequences I1J295
15368.BRADI5G23060.1 XP_003580627.2.954 EG:BRADI5G23060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]