SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G24180.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G24180.1
Domain Number 1 Region: 423-706
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.01e-74
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 305-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000738
Family Growth factor receptor domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G24180.1   Gene: BRADI5G24180   Transcript: BRADI5G24180.1
Sequence length 761
Comment pep:novel chromosome:Brachy1.0:5:25903395:25906914:-1 gene:BRADI5G24180 transcript:BRADI5G24180.1
Sequence
MVLFASTPSTKAKLGTIVAALELSLIVTILAAPVALPGCPEACGNITVPYPFGIRQGCSR
PGFNLTCDETRHPPKLFLGHGVEVDAISLADGTMRVQSKIVIVTTRDFNGSWSSGIMPNA
TISVSTEHNVFAVLRSNVIAHLAPSYNVSEQLYNSTCAALCDDYIYWTGTVWAWDRDAPC
SGVACCHTTIASGLPAYGVQFKDFSQKSYPVSDEVAFREDTPFSFAAAIVDSNWFSGNVG
LMFNNTYNNVHHGEVTVVPTVLDWWLEPRRDDDILFLDPNISIWRCISLNSVVNFVNNDV
RKVQSRCSCLDGYEGNPYIVNGCQDIDECQQPDVYSCVHGTCINMPGTYRCLSKKSIISL
PGLITVIAISAGLGLLFSVLGAAKITKKLKQQRAKKLRQKFFKKNHGLLLQQLISSNKDI
AERTRIFSWEELEQATNKFDNNRILGGGGHGTVYKGILSDQRVVAIKKAKIVVQRKIDQF
INEVVILSQTNHRNVVKLFGCCLETEVPLLVYEFISNGTLSFHLHGQSENPLTWTDRLRI
ALETARAIVYLHSAASISVYHRDIKCANILLADTLTAKVSDFGASRSIAIDETGILTAVQ
GTYGYLDPEYYYTSRLTEKSDVYSFGVILAELVTRVTPVFSSHSSEGTSLASHFVSIIRD
NRFLDILDTQIFEEGGTEDATVVARIAEACLSLKGEERPTMRQVEISLEDVKSSKVHHNS
QTTRVSQDALTDQSCKGNKVGEGTRLYSLEKEFIQSSEIPR
Download sequence
Identical sequences I1J2N8
XP_003580700.1.954 15368.BRADI5G24180.1 EG:BRADI5G24180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]