SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G24190.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G24190.1
Domain Number 1 Region: 410-696
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-74
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G24190.1
Domain Number - Region: 311-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00132
Family EGF-type module 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G24190.1   Gene: BRADI5G24190   Transcript: BRADI5G24190.1
Sequence length 749
Comment pep:novel chromosome:Brachy1.0:5:25909023:25911938:-1 gene:BRADI5G24190 transcript:BRADI5G24190.1
Sequence
MTISISSSRQLALVGMIGALAFELLVAAGPIALPGCPESCGRIAVPYPFGIGKGCSHPGF
NLTCDKTRHPPKLFLGNGVEVLGISLMDGTVWIRSNVLRSDFQEFNGSWPGPATVVPRPF
TVLSRRNWFVAYGCNIIARLMPPGVLGLVESDAYTSTCAAMCVGGQQNFTGSSCSGIARC
RTYIAWELLTHPYAIQVTQLSVLGGGSLPYTGVYVFVVDKDWFSRNEDEMLLNFTKSYQR
TITESVPAVLEWWLDLISDEDMLPLSVGPRSSYFRCSSLNSVSYYADLNYEKRRCNCSLG
YEGNPYITDGCQDINECQQPDVYPCVHGNCINMPGTYQCATKKSISRLPGLITVIAISAG
SGVLFSLLGIAKVTNKLKQQRAKKLRQKFFKKNHGLLLQQLISSNEDIAQRTKIFSLAEL
EQATNKFDNSRILGGGGHGTVYKGILSDQRVVAIKKAKIVVQRETDQFINEVVILSQTNH
RNVVKLFGCCLEMEVPLLVYEFISNGTLSFHLHGQSEDPLSWKDRLRIALETARAIAYLH
SAASISVYHRDIKCANILLTDTLTAKVSDFGASRSIAIDETGVLTAVQGTYGYLDPEYYY
TSRLTEKSDVYSFGVILAELLTRVTPVFSSHSSEGTSLASHFVSLLRDSRLLDILDAQIV
EEGGAEDATVVARIAEACLSLKGEERPTMRQVETALEDVQSSKVHHNSRTTRVSQNAVKG
HSCKGGKGDEGTRLYSLEKEFIQSSEIPR
Download sequence
Identical sequences I1J2N9
XP_010240529.1.954 XP_014751216.1.954 XP_014751217.1.954 XP_014751218.1.954 EG:BRADI5G24190.1 15368.BRADI5G24190.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]