SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G24480.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G24480.1
Domain Number 1 Region: 504-812
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-61
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 62-205
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-27
Family alpha-D-mannose-specific plant lectins 0.0016
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G24480.1
Domain Number - Region: 354-391
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000785
Family Pan module (APPLE domain) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G24480.1   Gene: BRADI5G24480   Transcript: BRADI5G24480.1
Sequence length 838
Comment pep:novel chromosome:Brachy1.0:5:26119269:26121785:1 gene:BRADI5G24480 transcript:BRADI5G24480.1
Sequence
MRALNILIGSAFLLLITSSPLSASERRRSTLRRGDALAVDDVLVSPSGNFSCGFHRAATN
AYTFSIWFTASADSTVAWSANRDSPVNGRGSLAALRDDGSLVLQDFDGRVVWSTNTSSGA
ADRALLLDTGNLVVSDASGRALWQSFDWPTDTLLPGQPITRYRRLVSSSARGLPYSGFYN
FYFDSNNILNLMYDGPEISSNYWPDPFNKWWDNNRTAYNSSRFAVLDARGRFSASDNLNF
NASDMDSGSGIAAMRRLTLDYDGNLRLYSLVGTIWRVTWAAVSRPCDVHGICGRYGVCAY
DGLSSAGAPACSCPEGFEVANAGDWSKGCKRKFEVPCGEDDVEFAEMPQVDYWGFDFNYT
EKLTFETCKQICLDDCNCEAFGYKKGTGKCYPKIALWNGRRPVGNQVIHLKVPRRLNNNG
SGKPLDPSKLFFSGHACTVREVSANVSSSYLRAAMTGSSKINFVYFYSFLAGLFVMEAIF
IAGGYLFVFRAADPAGRRIRDEGYSILLSHFRRFTYNELSSATTGFRDEIGRSASGAVYK
GVLEDGRSVAVTRLEELTQADEVFRSDLSVIGRINHMNLVRIWGFCSEHSHRLLVSEHVQ
NGSLDKALFFSDDGEHCVPPPLGWQARFGIAVGVAKGLAYLHHECLEWIVHCDVKPENIL
LGGDLEPKINDFGLAKLLSRRDEQGRVLSSVQGTRGYVAPEWALNLPITGKADVFSFGVV
LLELLRGQRVCDWAVEGEEEGKEVRMDFPRLVALLKEEMKDLKGVWMEQFVDARLRGDFG
HLQAATMLEVAVACVDDDPGRRPGMDAVVQRLLSAQDAVPPSLRHASSPRPELTHHTV
Download sequence
Identical sequences I1J2S3
15368.BRADI5G24480.1 XP_003579405.1.954 EG:BRADI5G24480.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]