SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G24620.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI5G24620.1
Domain Number - Region: 27-59
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.00968
Family Ribosomal protein L29 (L29p) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G24620.1   Gene: BRADI5G24620   Transcript: BRADI5G24620.1
Sequence length 69
Comment pep:novel chromosome:Brachy1.0:5:26202957:26203262:-1 gene:BRADI5G24620 transcript:BRADI5G24620.1
Sequence
MEGAAAQIVFPILGIVAAAAATFYAVSFMEIREKSLEELDEKYSEYEESGGRQRRARRRS
GRQAKKRND
Download sequence
Identical sequences I1J2U3
EG:BRADI5G24620.1 15368.BRADI5G24620.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]