SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G24870.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G24870.1
Domain Number 1 Region: 15-294
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-91
Family Protein kinases, catalytic subunit 0.00000902
Further Details:      
 
Domain Number 2 Region: 565-754,1017-1232
Classification Level Classification E-value
Superfamily ARM repeat 2.78e-33
Family HspBP1 domain 0.05
Further Details:      
 
Domain Number 3 Region: 1208-1318
Classification Level Classification E-value
Superfamily ARM repeat 0.0000553
Family Armadillo repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G24870.1   Gene: BRADI5G24870   Transcript: BRADI5G24870.1
Sequence length 1345
Comment pep:novel chromosome:Brachy1.0:5:26381665:26393219:-1 gene:BRADI5G24870 transcript:BRADI5G24870.1
Sequence
MGSRQLNNHKSKTLDNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLN
IIMQEIDLLKNLNHKNIVKYLGSLKTKSHLHIILEYVENGSLANIIKPNKFGPFPESLAA
VYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGT
PYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYELQPMPALFRIVQDVQPPIPEG
FSPEINDFLRQCFQKDAIQRPDAKTLLMHPWLQNSKRASPSLRQPVRPVRHIDEDEEAPS
GDNNAGFSGPQGDTKTPVASDIEQEDGTKELVSESAGRGNSDELHDGKPAESSSSNSVEI
MKDSVVLTKDPTLVFHEKPSLESSSGVTDLNGKVTNELSQDGLPSRNSQESKKGDSKNVE
PENKDRSSIEDDDAFSFQAGRQNIDFPKEAKPLVVEGANGLSRFSDTPGDASLDDLFPID
KRGDHGAIASTSTTSQELQYSGRQNDLAKELKDRMAKKQKENDNEHGGKLLEYIRFREDD
LDVAGFHDNIPGENLFPLQSVEYSKIVAQLKPGESEEVILSACQKLMLFFNHRPEQKQIY
VSQNGFLPLMELLELPKNRIICSVLQLINCIVKDNTSFLENACLVGLIPVVMNFAVPDRA
KEVRIQASFFLQQLCQASTLTLQMFIACQGIPVLVSFLEPDYAKFREMVHLAIDGIWQVF
KLQHSTLRNDFCRIAAKNGILLRLVNTLHSLNEATRFASISGSGASVTQNGSTPRLKSGQ
LDQPMLESSKARLDHYHSSGSLQSLQADADKHHILLEPSASPRFNDITAGHMERNDNDLV
KPQRLSVSGGRSSTDRSPKHIELVSNGHSGGQNDQIRPLLSLLEKEPPSRHVSGQLDYVR
HISGLERHESILPLLHASTERKTNGELDLLMSEFNEVSRQGRENVNPDSSIKASNRVLSM
KYAPSSGATASNEGASTSGAASQTASGVLSGSGVLNARLPGSTTSSGLLAQMISMSADVA
REYLEKVADLLLEFAQADTVVKSLMSSQSLLARLFQMFNKIESPILLKILRCINHLSGDP
NCLETLQRTDAIKHLIPILELRDGPLIYQIHSEVLNALFNLCKINKRRQEQAAENGIIPH
LMSFVMSDSPLRQYALPLLCDMAHASRNSREQLRAHGGLDVYLNLLEDDAWACTALDSIA
VCLAHDNDHRKVEQALLKKEAIQKLVKFFQDCPEQYFVHILDAFLKIITKSSRINTAIAT
NGLTTLLIARLDHREAIARLTLLKLIKVVYEHHPRPKQLIVENDLPQKLQNLIEERRDGQ
RGGQQVLVKQMATSLLKALHINTVL
Download sequence
Identical sequences I1J2X1
XP_010240555.1.954 EG:BRADI5G24870.1 15368.BRADI5G24870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]