SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G25390.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G25390.1
Domain Number 1 Region: 894-1243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-120
Family Motor proteins 0.0000000000813
Further Details:      
 
Domain Number 2 Region: 374-491
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-20
Family Second domain of FERM 0.0023
Further Details:      
 
Domain Number 3 Region: 496-584
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000012
Family Phosphotyrosine-binding domain (PTB) 0.054
Further Details:      
 
Domain Number 4 Region: 835-918
Classification Level Classification E-value
Superfamily Prismane protein-like 0.00000861
Family Acetyl-CoA synthase 0.026
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G25390.1
Domain Number - Region: 273-322
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0713
Family Ubiquitin-related 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G25390.1   Gene: BRADI5G25390   Transcript: BRADI5G25390.1
Sequence length 1270
Comment pep:novel chromosome:Brachy1.0:5:26726429:26736404:-1 gene:BRADI5G25390 transcript:BRADI5G25390.1
Sequence
MPAGGGSVNVGNGAAGSPATPLHGSGSASAAASVNGDGYDSDGYNFAPPTPSTLSMSIPP
ELAGAIPLIDRFQVEGFLKAMQKQIQSSGKRGFFIKKSVGPQVREKFTLEDMLCFQKDPI
PTSLLKVTNDLVSRSIKLFHVILKYMGIDSPAIISLDERIELVAKLYKHTLKRSELRDEL
FAQISKQTRNNPDRSWLIRAWELMYLCASSMPPSKDIGAYLSEYVHYIAHGATTDSDVRV
LALNTLNALKRSVKAGPRVTIPAREEIEALLTSRKLTTIVFFLDETFEEITYDMATTVAD
AVEELAGIIKLSVYSSFSLFECRKIVNGSKSSEVGNEEYIGLDDNKYIGDLLSEFKSAKD
RNKGEILHCKLVFKKRLFRESDEAVTDPMFVQLSYVQLQHDYILGNYPVGRDDAAQLTAL
QILVEIGFVENPETCVEWISLLERFLPRQVAITRAKRDWELDIISRYQLMEHLSKDDARN
QFLRILRTLPYGNSVFFSVRKIDDPIGLLPGRIILGINKRGVHFFRPVPKEYLHSAELRD
IMQFGSSNTAVFFKMRVAGVLHIFQFETKQGEEICVALQTHINDVMLRRYSKARSGSVTS
TVSQNDVSQVDKQPHVETYEKRVQELSKEVDESQKKADQLRDELERKTKLEREMQEELEG
LRDTLQSERHVIKEVTSQRDKLKSLCDEKDSSLQVALVEKSRLETRLTSQGQEINKKIEV
RDTLTTAGSLNSDIEMVTKLEEGLKSCQKELDASKEISKKLITERNLLEQQVQRLERAKS
EEKSKMERVYEDECRKLKARAAELEQRLESTSRSLNVAESTLALRNVEVDKLQNTLKELD
ELREFKADVDRKNQQTVEILKRQGAQLVELESLYKQEQVLRKRYYNTIEDMKGKIRVFCR
LRPLTEKEIAVRDKNIVCSPDEFTIAHPWKDDKSKQHIYDRVFDAYTTQEDVFEDTKYLV
QSAVDGYNVCIFAYGQTGSGKTFTIYGAENNPGLTPRATSELFRVIKRDGNKYSFDLKAY
MVELYQDNLVDLLLPKNATRQKLEIKKDSKGVVTVENVTLVNISSYEELRAIIARGSERR
HTAGTNMNDESSRSHLILSIIIESTNLQSQSYARGKLSFVDLAGSERVKKSGSAGKQLKE
AQSINKSLSALADVISALSSDGQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPAESNLE
ETYNSLMYASRVRCIVNDTSKHVAPKEIMRLKKLISYWKEQAGKRSEGDELEEIQEERIS
KEKTDTRLTA
Download sequence
Identical sequences I1J339
XP_010240574.1.954 EG:BRADI5G25390.1 15368.BRADI5G25390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]