SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G26420.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G26420.1
Domain Number 1 Region: 431-629
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.68e-35
Family ABC transporter ATPase domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 140-368
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000017
Family DNA repair protein MutS, domain III 0.028
Further Details:      
 
Domain Number 3 Region: 854-925
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000379
Family Smr domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G26420.1   Gene: BRADI5G26420   Transcript: BRADI5G26420.1
Sequence length 927
Comment pep:novel chromosome:Brachy1.0:5:27432305:27436916:1 gene:BRADI5G26420 transcript:BRADI5G26420.1
Sequence
MATVATITSRSSNLTLLFFTSTPPFRVALPSRRLPRSHRHAPQLLRLRTAASASSRTLMP
PVSPEAREAAEELRLEAESALEWGGVCARLADFAATAAGRAACGDGRVPVGRSREESERL
LEQTAAAAALLSSSSSAPLDFGGVGDVSAVVAAAARGRLLAVREICGVGRSLRAARGVFD
QVKGLTDEMPDERYSPLLDILQDCDFLTELVQMIEFCLDSNLSMVLDRASEKLGTIRKER
RSNIEILESLLRDASMKIFQAGGVDSPLVTKRRSRMCVGVKASHKHLLPGGIVLSSSGSG
ATYFMEPRDAVKLNNMEVKLSSDERTEELAVLGLLTSRIADSRMKIRHLMGKIMELDLAC
ARGSYALWINGVRPAFSDRDNSGQLDPSSDFSVFIDGIQHPLLLEQSFGIAKGSTEVGKG
QLSEEHPVSSMPVPLDMHVKSDTRIVVISGPNTGGKTATMKTLGLATLMSKAGMFFPAKG
SPKLPWFDQVLADIGDHQSLENSLSTFSGNISRLRKIVQVVSRDSLVLIDEIGSGTDPSE
GVSLSTSILKYLAGRLNLAIVTTHYADLSRLKAVDGRFENAAMEFCLETLKPTYRILWGS
TGNSNALSIAKSIGFDQKVLDRAQEWVEKLLPDKQKERQGLLYGSLLDERNLLESQANEV
ASVLSEVEVLYNEICLEADDLDNRVAALRARESQKVQHELKLVKSQMDLIIRNFEVQLKN
SKLEQYNSVMKKAEASTASLAAAHQPTEFAFSDDENKSSYVPQIGDKVYVEGLGGGSLAT
VVEILSEDGSCMVQYGKIKVRAKNNKMKLAQRDTKETSASSSVQGKGRPVKRSSPETKQD
GSISFGPVVQTSKNTVDLRGMRVSEASHELQMAIDGCRSYQVLFVVHGMGTGAVKECALD
ILRSHPRVAKLEDESPLNYGCTVAYIE
Download sequence
Identical sequences I1J3G0
EG:BRADI5G26420.1 15368.BRADI5G26420.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]