SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G26812.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G26812.1
Domain Number 1 Region: 935-999,1030-1275
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.27e-55
Family DNA repair protein MutS, domain III 0.0027
Further Details:      
 
Domain Number 2 Region: 1276-1530
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-48
Family ABC transporter ATPase domain-like 0.00000428
Further Details:      
 
Domain Number 3 Region: 603-717
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 7.98e-27
Family DNA repair protein MutS, domain I 0.0011
Further Details:      
 
Domain Number 4 Region: 100-139
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 0.0000131
Family DNA repair protein MutS, domain I 0.014
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G26812.1
Domain Number - Region: 267-293
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.017
Family DNA repair protein MutS, domain III 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G26812.1   Gene: BRADI5G26812   Transcript: BRADI5G26812.1
Sequence length 1605
Comment pep:novel chromosome:Brachy1.0:5:27677279:27692260:1 gene:BRADI5G26812 transcript:BRADI5G26812.1
Sequence
MGKQPKQQVLSRFFAPSAAPKPPAALPPNPPASTVAFFSPAKRARALSRSPKTPDAKKIQ
TLLILLRPRSRCRPPQAPRAASLRAAGGVGGRGGIVAHPDRSFLTASVPTFRLGFHDHRL
VAAGHKVGVVRQTETATIKAAHGGAAAGAPTIEASTRELEGGGAPEEGSRYLVWVMDKEV
DAVGREGFEVKVGVGAVEVSTGKVVLGEFMDGASWSGLAPVEVILGTPLSFSAEKGIMAM
PELVVQAMALIVHYLKGFANALQQLELTHPLCDRNLICARHDAVSEISESMGSRSIQIAC
YMMERMGAAHLLCELCIGRLGTVAHTSIYFARLREDGTLLPKPSPSRKPTTSLFLLLAAA
SSGDHRSPRRKRKSESSARRRKEMVSASSSSVVNVYPLANYTFGTKEPKMEKDTSVADRL
ARMKVNYMKEGMRTSVEAIMLMIPFKSLSVSSWDWNSAEIDGLKRKLCSKLGVNSPSFPP
NWQVGECVGVWWRPNFDNVMYPYCPPHITKPKECKKLFIVHLTEREYFAIPRKLKLRAVP
LFEIYDNVQRFGPVISTIPLQLSRFQFNMVSSLLEPPLSALPAPTAVPRLPASNPSSSGS
GSGKGYTPLEQQVVDLKARHPDVLLMVEVGYRYRFFGEDAAAAASVLGIVAHPDRSFLTA
SVPTFRLGFHVRRLVAAGHKVGVVRQTETAAIKAAHGGAAAGAPFARGLSAVYTRATIEA
SAGELEGGGAPEEGSRYLVCVVDREAEAVGREGFEVKVGVVAVEVSTGEVVHGEFMDGAS
RSGLEAVLLGLAPVEVILGTPLSFATEKLMRAYAGPASNVRVECTPRMCFGEAGALAELL
SFFEKSEVNSPTIENNRQMIEISEADNSCHGIDNNRQGIDNDLHGIEGIMALPELVVQAM
ALIVRYLKGFGMERLICFGSSFRPFSANTEMSLSANALQQLEVLKNNSDGSVEGSLFQAM
NNTCTAFGSRLFRHWLTHPLCDRNLICARHDAVSEISESMGSRQHSDSMLHDGEDGGCTA
SVRSDLSTVLSSILTMLGRSLDSQRGITRIFHCKATAKEFVGVIEAILTAGKQLQKLVLE
DTDTVSSQRKSVHSSLLRRLISTASSSTVLSNAVKLLSCLNKDAADQGDMLNIFIASVDQ
FPEVAEGHVTVEMAKRKLDLLIVEYRKQLGMRNLEYKTVAGTTYLIELPVDRRVPSNWMK
VNSTKKTIRYHTPEIVKNLDNLVLAKEELAVICRTTWHTFLMDFGKYYAQFQATVESLAA
LDCLYSLATLAKQNNYVQPNFVPENEASQIHIKDGRHPVLESLLGDNFVPNDTDLQADEE
YCQIVTGPNMGGKSCYIRQVALITIMAQVGSFVPASSARLHVVDGIYTRMGASDSIQQGT
STFYEELNEASNILHNCSSRSLVIIDELGRGTSTHDGVAIAYATLQYLLKEKKCIVIFVT
HYPKILDIQREFEGSVGAYHVSYLSTRKLLEITDEKMEIGTETEDLGEITFLYKLVAGAS
DRSFGLNVALLAQLPLSCIRRASVMAAKLQEELSEREENKVGRLMEKPAGHSPKAVCAAQ
PYQGLMEACRRILGDMRCVESSNDLTDTLSHLRNAKEIAVKTTKG
Download sequence
Identical sequences I1J3K7
EG:BRADI5G26812.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]