SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G06160.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G06160.1
Domain Number 1 Region: 721-1340
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 2.09e-162
Family Molybdenum cofactor-binding domain 0.00000000442
Further Details:      
 
Domain Number 2 Region: 215-417
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.73e-36
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0012
Further Details:      
 
Domain Number 3 Region: 583-718
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 3.66e-33
Family CO dehydrogenase molybdoprotein N-domain-like 0.0003
Further Details:      
 
Domain Number 4 Region: 105-206
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 5.36e-29
Family CO dehydrogenase ISP C-domain like 0.00027
Further Details:      
 
Domain Number 5 Region: 17-102
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.06e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00052
Further Details:      
 
Domain Number 6 Region: 436-540
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 0.00000000000000353
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G06160.1   Gene: BRADI1G06160   Transcript: BRADI1G06160.1
Sequence length 1357
Comment pep:novel chromosome:Brachy1.0:1:4124906:4132513:-1 gene:BRADI1G06160 transcript:BRADI1G06160.1
Sequence
MGSLGKPAAAAAAGERVVLAVNGARHEEAGVDPSTTLLEFLRTRTPVRGPKPGCGEGGCG
ACVVLISKYDPTTDEVTEFSASSCLTLVNSVNFCSVTTSEGIGNTRDGYHPVQQRLSGFH
ASQCGFCTPGMCMSIFSALVKADKPKPGGEPAAPPGFSKLTSCEAEHAVSGNLCRCTGYR
PIIDACKSFAADVDLEDLGLNTFWKKGCADVGKLPEYSADSVCTFPDFLKSEIKSLIPPE
VITGDDSSWFHPQSIRELHSLSDSDWFDDNSVKIVASNTGSGVYKDQDLHDKYIDIKGIP
ELSVINRSSKGVEIGAAVSIAKAIEVFSDGTPVFSKIADHLSKVATPFVRNTATIGGNLI
MAQRLEFPSDIATVLLAAGSTVTIATASKKMLCLTLEEFLEQPPCDVRTILLSVSVPDWG
SENVIFETSRASPRPFGNAVSYVNSAFLARTSLYAASGGILIEDICLAFGAYGGNHAIRA
RKVEEFLKGKSVSAPVILEAVRLLKEAILPSEGTTHPEYRVSLAVSFLFSFLSSLANGLD
EPAKAIAPNGSCANGIMNGSVKSSPQKHVEVASDYLPIRSRQEMVFNDEYKPVGKPVMKA
GVELQASGEAVYVDDIPAPKDCLYGAFIYSTHPHAHIKSVNFKSSLASQKVITVISAKDI
PNDGANIGSSFPMFGDEALFGDPVSEFAGQNIGIVIAETQQYAYMAAKQAMIEYSTEKLE
PPILTIEDAIQHDSYFHTPPFLAPTQIGDFDKEMSKADHKILSGEVKLESQYYFYMETQT
ALAIPDEDNCITVYSSTQTPEVTQGVIAKCLGIPLHNVRVITRRVGGGFGGKAMKGCHVA
CAVAVAAFKMRRPVRMYLDRKTDMIMAGGRHPMKAKYSVGFKSDGTLTALRLDLGINAGI
SPDISAMMPMSIIGALKKYNWGALSFDVKVCKTNMSSKSAMRAPGDVQGSFIAEAIIEHV
ASMLGADTNAVRKKNLHGIDSLKVFYGDAAGEEPTYSLVTMFDKLAASPEYKQRVAAVER
FNGGSRWKKRGISCVPITYEVRLRATPGKVSILNDGSIAVEVGGIEIGQGLWTKVKQMAA
FGLGPLCPDGEGPLDMVRVIQADSLSMIQGGFTGGSTTSENSCEAVRLSCAELVERLMPI
KKSLEATSGTRPSWTALIAQATMASVNLAAHAYWKPDPSFVSYLNYGAGVSEVEVDVLTG
AMTILRSDLVYDCGQSLNPAVDLGQVEGAFVQGVGFFTNEEYATNADGLVINDGTWTYKI
PTVDTIPKQLNVELINSAPDHKRVLSSKASGEPPLLLASSVHCAMREAIRAARKEFAVDS
PLTFQMDVPATMATVKELCGLDVVERHLESLSAAAKA
Download sequence
Identical sequences I1GMF4
XP_003559341.1.954 15368.BRADI1G06160.1 EG:BRADI1G06160.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]