SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G52740.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G52740.2
Domain Number 1 Region: 708-1214
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 2.36e-125
Family Molybdenum cofactor-binding domain 0.0000000594
Further Details:      
 
Domain Number 2 Region: 195-419
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.14e-39
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0012
Further Details:      
 
Domain Number 3 Region: 574-706
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 2.22e-30
Family CO dehydrogenase molybdoprotein N-domain-like 0.00033
Further Details:      
 
Domain Number 4 Region: 94-195
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.96e-28
Family CO dehydrogenase ISP C-domain like 0.00023
Further Details:      
 
Domain Number 5 Region: 5-92
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.51e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00047
Further Details:      
 
Domain Number 6 Region: 429-541
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 0.000000000000262
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G52740.2   Gene: BRADI1G52740   Transcript: BRADI1G52740.2
Sequence length 1214
Comment pep:novel chromosome:Brachy1.0:1:51099796:51112054:-1 gene:BRADI1G52740 transcript:BRADI1G52740.2
Sequence
MKVEKVVFALNGRRYEVVDADPSTTLLEFIRTRTPFKGTKLGCGEGGCGACVVLIAKYNP
TKDQVTEFSASSCLTLLYNINFCSVITTEGLGSTQDGFHAIQKRMSGFHASQCGFCTPGM
CMSIFTSLVNADKSKNLEPQNGFSKLSVSEAERAFSGNLCRCTGYRPIVDVCKSFASDVD
LEDLGLNIFWKKGDKSADVSKLPSYTLGGGVCTFPDFLKSEMKSSLDYLNDSNVAVSREG
WYHPKSIEQYYYLLNSGIFSDCSVKVVVGNTSAGVYKDQDLYNKYIDIGGIPELSAISRK
DGGIEIGAATPISRTIEVLKQDNDSMSCPNGSVVFRKLAEHMSKVATPFVRNTASLGGNI
ILAQKYPFASDIATILLGAASTVCLQVTSERLEVTLEEFLEQPPLDPSTLLLSIFIPHWF
SDSQKETNVIFETYRAAPRPLGNAVSYINSAFLGNVSLHGSSSDLVLSNLHLAFGAYGTE
HAIRATKVEEYLTGKLLTPSVVLQAVRLLRGTIVPKEGTSHPEYRVSVAVGFLFSFLYPL
VKGMTGPEKTLSIGCSSSVEEASLPLSSRRETVPSDEYKPVGEPIKKYGVELQASGEAVY
VDDIPAPKDCLYGEFIYSTQALAYVKGMKFKPSLASEKIITVVSANDIPSGGQNIGSTFM
FGDEPLFGAPIAEFAGQALGVVIAETQRYADLAAKQVVIEYATEDLKPPILTVEQAVQNN
SYFKVPPERYPKQVGDFSKGMAEADHKILSTEVKLASQYYFYMETQTALAVPDEDNTMVV
YSSSQYPELAQSVIAKCLGIPFSNVRVITRRVGGGFGGKAFRSYNVATAAALCANKLRRP
VRMYLNRSTDMIMVGGRHPVKAYYSVGFKSDGKITALHLDVLINAGISPDASPIIPDTII
SGLKKYNWGALSFDIKLCKTNNTSKSVMRAPGDTQGSFIADAIIEHVASVLSLDANTVRQ
KNFHTYDSLVLFYPESAGESSTYTLHSIFDRLLMTSSYLHRAESIKQFNSCNNWRKRGIS
CVPLIFKVAPRPAPGRVSVLNDGSIIVEVGGIEIGQGLWTKVQQMTAFALGQLWPDGCEC
LLDRVRVLQADTLNLIQGGLTAGSTASESSCAATLQACNMLTDRLKPVMDKLKQQSGAVS
WDSLISQASQDNINLSSTAYWVPGQESSSYLNYGAGISEVEIDLLTGAITLLRSDLVYDC
GKSLNPAVDLGQVY
Download sequence
Identical sequences I1H292
EG:BRADI1G52740.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]