SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G59110.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G59110.1
Domain Number 1 Region: 16-94
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.25e-26
Family eIF5a N-terminal domain-like 0.00023
Further Details:      
 
Domain Number 2 Region: 87-157
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2e-25
Family Cold shock DNA-binding domain-like 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G59110.1   Gene: BRADI1G59110   Transcript: BRADI1G59110.1
Sequence length 161
Comment pep:novel chromosome:Brachy1.0:1:58230452:58232577:-1 gene:BRADI1G59110 transcript:BRADI1G59110.1
Sequence
MSDSEEHHFESKADSGASKTYPQQAGTIRKSGHIVIKGRPCKVVEVSTSKTGKHGHAKCH
FVAIDIFNGKKLEDIVPSSHNCDIPHVDRQDYQLIDITDDGFVSLLTENGGTKDDLKLPT
DDALLTQIKDGFDAGKDLILSVMSAMGEEQICAVKEIGGGK
Download sequence
Identical sequences I1H4B2
15368.BRADI1G59110.1 XP_003557675.1.954 EG:BRADI1G59110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]