SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G07347.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G07347.1
Domain Number 1 Region: 474-760
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-78
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 106-189
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000471
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G07347.1
Domain Number - Region: 126-167,194-293
Classification Level Classification E-value
Superfamily Nucleoporin domain 0.068
Family Nucleoporin domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G07347.1   Gene: BRADI2G07347   Transcript: BRADI2G07347.1
Sequence length 788
Comment pep:novel chromosome:Brachy1.0:2:5685723:5688428:-1 gene:BRADI2G07347 transcript:BRADI2G07347.1
Sequence
MPLNGGGAARPLDLDLSPPKPAAQAFLFLMLCGGDFWAGTASAADTILPGEPISGNQTLV
SKSGAFDLGFFPPGPGIHYFLGVRLRNMAGNSPTFWVGDRVVITDLPSASLELFGDSLYI
KQGGASLWWSPPAGNGSTPAAAVAVLLDNGNLVVRDRENSSLVLWQSFDYPGDALLPGGR
LGFDRDTGKNVSLTFRDFSHNGSLAVDASRRNGFVLTTDGHDHRGTFPDWMVSSRDNGSS
LLLNRPESPNGTEFLQFHLGQVSLMRWSESNPAAGNGSTPGWVARWTFPSGCKSGGFFCG
DFGACTSTGKCICVDGFAPSYPIEWGLGYFVTGCSRSLPLSCESGGQTEHDDSFAPLDSL
QGLPYNAQDEVAGTDEDCRAACLSKCYCVAYSYGHGHGCKLWYHNLYNLSLAAIPPYSKV
YIRLGSKIRNNKGLQTKGIALLVAGSVAIASLILVLVLIWRFRRNSSAAKKFEVEGPLVV
YPYAHIKKATMNFSDKIGEGGFGSVFKGTMQGSTVVAVKNLKVLGQAEKQFRTEVQTLGM
IQHSNLVRLLGFCVRGNRRLLVYEYMPNGSLDAHLFADKSGLLSWNVRYQIALGIAKGLA
YLHEECEDCIIHCDIKPENILLDAEFCPKIADFGMAKLLGREFNSALTTIRGTMGYLAPE
WISGLPITKKADVYSFGIMLFEIISGRRSTEMMKFGNHRYFPLYAAAQVNEGEVLCLLDG
RLKADANVKQLDVTCKVACWCIQDEENDRPSMGQVVHMLEGLVNTKMPPIPASFQNLIEG
DNSAIYSE
Download sequence
Identical sequences I1HDE9
EG:BRADI2G07347.1 XP_003565759.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]