SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G48990.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G48990.1
Domain Number 1 Region: 22-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.1e-30
Family Heat-shock transcription factor 0.00097
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G48990.1
Domain Number - Region: 114-176
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G48990.1   Gene: BRADI2G48990   Transcript: BRADI2G48990.1
Sequence length 247
Comment pep:novel chromosome:Brachy1.0:2:49157121:49158267:1 gene:BRADI2G48990 transcript:BRADI2G48990.1
Sequence
MGSECKGHHQVQDDEAGGPGAIAPFVAKTFHMVSDPATDGVVRWGGASNTFLVLDPAAFS
DLLLPSYFKHRNFASFVRQLNTYGFRKVDPDSWEFAHESFLRGQAKLLPLIVRKKKKAGA
RGELCEEEEEVRGTIRAVQRLRDERKGMEEELQAMDRRLRAAENRPGQMMAFLGKLADDP
GVVLRAMVAKKEELSAAAGGGKDSSSPQKRRRIIGAEAGRGGAVSAADAAESRAVPFPFS
ALGQVFY
Download sequence
Identical sequences I1HR89
EG:BRADI2G48990.1 XP_003569736.1.954 15368.BRADI2G48990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]