SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G56750.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G56750.1
Domain Number 1 Region: 677-945
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-67
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 74-351
Classification Level Classification E-value
Superfamily RNI-like 2.82e-50
Family Cyclin A/CDK2-associated p19, Skp2 0.058
Further Details:      
 
Domain Number 3 Region: 252-562
Classification Level Classification E-value
Superfamily RNI-like 2.04e-49
Family 28-residue LRR 0.082
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G56750.1
Domain Number - Region: 39-80
Classification Level Classification E-value
Superfamily V-region of surface antigen I/II (SA I/II, PAC) 0.0405
Family V-region of surface antigen I/II (SA I/II, PAC) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G56750.1   Gene: BRADI2G56750   Transcript: BRADI2G56750.1
Sequence length 948
Comment pep:novel chromosome:Brachy1.0:2:55013723:55016931:1 gene:BRADI2G56750 transcript:BRADI2G56750.1
Sequence
MPTSPLQIYFWCILLFANVGISTSLPLETDALLDIKSHLEDPEKWLHNWDEFHSPCYYYG
VTCDKLSGEVIGVSLSNVSLSGTISPSFSLLRRLHTLELGANSISGIIPAALANCTNLQV
LNLSMNSLTGQLPDLSPLLKLQVLDLSTNNFSGAFPVWISKLSGLTELGLGENNFTEGDV
PESIGVLKNLTWLFLGKCNLRGDIPASVFDLVSLGTLDFSRNQMTGMFPKAISKLRNLWK
IELYQNNLTGEIPPELAHLTLLSEFDVSQNELTGILPREISNLKNLKIFHIYMNNFYGEL
PEGLGDLQFLESFSTYENQLSGKFPANLGRFSPLNAIDISENYFSGEFPRFLCQNNKLQF
LLALNNNFSGEFPSSYSSCKKLERFRISQNQFAGSIPYGIWGLPNAVIIDVADNGFIGGI
SSDIGISANLNQLFVQNNNFSSELPLELGKLSQLQKLIAFNNRFSGQIPTQIGNLKQLSY
LHLEHNALEGSIPPNIGLCNSLVDLNLAENSLSGNIPDALASLLMLNSLNLSHNMISGEI
PQRLQSLKLSYVNFSHNNLSGPVSPQLLMIAGEDAFSENYDLCVTNISEGWRQSGTSLRS
CQWSDDHHNFSQRQLLAVVIMMTFFLVLLSGLACLRYENNKLEDVSRKRDTESSDGSDSK
WIVESFHPPEVTAEEVCNLDGESLIGYGRTGTVYRLELSKGRGIVAVKQLWDCIDAKVLK
TEINTLRKICHRNIVKLHGFLAGGGSNFLVYEYAVNGNLYDAIRRKFKAGQPELDWARRY
RIAVGAAKGIMYLHHDCSPAIIHRDVKSTNILLDEDYEAKLADFGIAKLVETSPLNCFAG
THGYIAPELTYSLKATEKSDVYSFGVVLLELLTERSPTDQQFDGELDIVSWASSHLAGQN
TADVLDPRVSNYASEDMIKVLNIAIVCTVQVPSERPTMREVVKMLIDI
Download sequence
Identical sequences I1HTY3
15368.BRADI2G56750.1 XP_010232642.1.954 EG:BRADI2G56750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]