SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G57590.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G57590.1
Domain Number 1 Region: 443-479
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000564
Family SPT5 KOW domain-like 0.023
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G57590.1
Domain Number - Region: 547-573
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000314
Family N-utilization substance G protein NusG, C-terminal domain 0.05
Further Details:      
 
Domain Number - Region: 390-424
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000978
Family N-utilization substance G protein NusG, C-terminal domain 0.062
Further Details:      
 
Domain Number - Region: 924-957
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0125
Family Ribosomal proteins L24p and L21e 0.084
Further Details:      
 
Domain Number - Region: 665-698
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0426
Family N-utilization substance G protein NusG, C-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G57590.1   Gene: BRADI3G57590   Transcript: BRADI3G57590.1
Sequence length 986
Comment pep:novel chromosome:Brachy1.0:3:57306151:57312905:-1 gene:BRADI3G57590 transcript:BRADI3G57590.1
Sequence
MGRRREDEEEEEEEGAYYSEEEEERRGGKGSRGGRGKRSRVESFIDDAASEDEEEEEEED
DDEDYDGGGGRGRASRRSFIDDARADNPDENVGRISRLHSNPMEEEDDTEKMAAYILRRY
KEPSNFDYVDEELTEVEQQALLPSVNDPKLWMIGHERETAICLMQKFIDRPDLQIISVVA
LEHLKNYIYVEAEKEAHVKEACKGLRNIFTSAKITMVPTREMTDVLSVTSKSVDLSSDTW
VRMKLGIYKGDLAKVVDVDDMRHKVIVKIIPRIDLQALSNKLNGLEIAKKKKSFGQNDLD
VAKKKKSLVPPPRFFSVDEAREMDIRVERKRDRNSGEYFEVVGGLMFKDGFLHKTVSRKS
ISIQNVRPSLDELERFRGVGDDMNEDMASLFINRKKGHFMKGDAVVVVKGDLKNLLGHVE
KVEDDTVHMRPKRPDLLSTLVFSEKDLCKHFNPGDHVKVVSGVREGATGMIRVFADHVVE
SSEITTGITRIGDYELHDLVLLGDLSFGIIVLKGVPEKLELVLVTLREIKCKIDRRTSAE
DSKGNIVSTKDVVRVIDGKFKGKQGSVEHIHKGILFIHDRHYLEHSGFICAKARSCFLVG
GSIGNSRGMGMDTADPRHGAFRSPARIFESPGRLPPRGPYANFGGRFGRGGRGGRGNDAL
VSKCIKIKSGPYKGYRGRVKEVNGALVRVELDSLMKIVAVKREDIADTDTVATPLRESRP
SWGSETPMHPSRTPLRPIQTPMWEPGATPDGTQTPIHNQAWAPMSPPRDNQEDGNPGTWG
TWGSSPAYQPGTPVVKPYEAPTPGSGWATIPGSGFGDTPGNAPTQPTAQPVTPIPTSYLP
GTPGGQPMTPGNIGMDIMSPAIGDEGESNWLLPEVLVNVSRADGSTSGVVKEVLPDGSCR
IALGSSGSGDEVTASPDELQIVRPKKNDALKIMNGSMRGVTGKLIGVDGSDGIVRVRVEG
TLETKIVDMVILGKLATQDSYAGEFS
Download sequence
Identical sequences I1IEQ5
EG:BRADI3G57590.1 15368.BRADI3G57590.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]