SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G25740.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G25740.1
Domain Number 1 Region: 40-102
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.51e-18
Family eIF5a N-terminal domain-like 0.0033
Further Details:      
 
Domain Number 2 Region: 107-171
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000175
Family Cold shock DNA-binding domain-like 0.0083
Further Details:      
 
Domain Number 3 Region: 170-226
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000125
Family Cold shock DNA-binding domain-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G25740.1   Gene: BRADI4G25740   Transcript: BRADI4G25740.1
Sequence length 226
Comment pep:novel chromosome:Brachy1.0:4:31080758:31083311:-1 gene:BRADI4G25740 transcript:BRADI4G25740.1
Sequence
MAALRHLAAGATSSSFDLRRPPSFCLAGTRPLRLRSRLARVYALSSNDIKVGLNLEVDGA
PWKILEFLHVKPGKGAAFVRTKMRNYVSGNTVEKTFRAGSTIQEASISKETKQFTYKDGP
QFVFMDLTTFEESRLNESDVGDKQKWLKEGMDCNLLYWNGRIIDFDLPITVRLTVTETDP
GQGDSAQGGTKPATLETGAVVNVPSFVDVGDDVLIDSRTGQYMSRA
Download sequence
Identical sequences I1INJ7
15368.BRADI4G25740.1 XP_003577846.1.954 EG:BRADI4G25740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]