SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G03860.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G03860.1
Domain Number 1 Region: 1904-2294
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.38e-101
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000232
Further Details:      
 
Domain Number 2 Region: 1581-1900
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.31e-74
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000542
Further Details:      
 
Domain Number 3 Region: 259-497
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.73e-63
Family BC ATP-binding domain-like 0.000000192
Further Details:      
 
Domain Number 4 Region: 106-258
Classification Level Classification E-value
Superfamily PreATP-grasp domain 8.73e-50
Family BC N-terminal domain-like 0.00000296
Further Details:      
 
Domain Number 5 Region: 526-639
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 5.07e-29
Family BC C-terminal domain-like 0.0000103
Further Details:      
 
Domain Number 6 Region: 775-845
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0000000000733
Family Biotinyl/lipoyl-carrier proteins and domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G03860.1   Gene: BRADI5G03860   Transcript: BRADI5G03860.1
Sequence length 2335
Comment pep:novel chromosome:Brachy1.0:5:4882251:4895452:1 gene:BRADI5G03860 transcript:BRADI5G03860.1
Sequence
MGSTHLPIVGFNASTTPSLSTLRQLNSAGTAFQSSAPSRTSPKKKSRRVQSIREDGDGGV
SDPAGHNKSIRQGIAGIIDLPKEGTSAPEVDISHGSEDPRGSYQMNGILNEAHNGRHASL
SKVVDFCMALGGKTPIHSVLVANNGMAAAKFMRSIRTWANDTFGSEKAIQLIAMATPEDM
RINAEHIRIADQFVEVPGGTNNNNYANVQLIVEIAERTGVSAVWPGWGHASENPELPDAL
TAKGIVFLGPPASSMNALGDKVGSALIAQAAGVPTLPWSGSQVEIPLELCLDSIPEEMYR
KACVTTAEEAVSSCQMIGYPAMIKASWGGGGKGIRKVNNDDEVRALFKQVQGEVPGSPIF
IMRLASQSRHLEVQLLCDQYGNVAALHSRDCSVQRRHQKIIEEGPVTVAPRETVKELEQA
ARRLAKAVGYVGAATVEYLYSMDTGEYYFLELNPRLQVEHPVTEWIAEVNLPAAQVAVGM
GIPLWQVPEIRRFYGMDHGGGYDIWRKTAALATPFNFDEVDSQWPKGHCVAVRITSEDPD
DGFKPTGGKVKEISFKSKPNVWAYFSVKSGGGIHEFADSQFGHVFAYGVSRSAAITSMAL
ALKEIQIRGEIHSNVDYTVDLLNASDFRENKIHTGWLDTRIAMRVQAERPPWYISVVGGA
LYKTITTNTATVSDYVSYLIKGQIPPKHISLVNSTVSLNIEESKYAIETIRSGHGSYRLR
MNGSVIEANVQTLCDGGLLMQLDGNSHVIYAEEEAGGTRLLIDGKTCLLQNDHDPSRLLA
ETPCKLLRFLVADGAHVDADVPYAEVEVMKMCMPLLSPAAGVIHVLLSEGQAMQAGDLIA
RLDLDDPSAVKRAEPFDGFFPEMSLPIAASCQVHKRCAASLNAARMVLAGYEHPINKVVQ
DLVCCLDTPELPFLQWEELMSVLATRLPRDLKSELEGKYSDYKLTVDHGKNKDFPTKTLR
GIIEENLACCSEKEKATNERLVEPLMSLLKSYEGGRENHAHFIVKSLFEEYLSVEELFSD
DIQSDVIERLRLQHSKDLQKVVDIVLSHQGVRNKTKLILTLMEKLVYPNPSAYRDQLIRF
SSLNHKRYYKLALKASELLEQTKLGELRTSIARSLSELEMFTEERVGLSLQERTLAIDES
MGDLVTAPLPVEDALISLFDCTDQTLQQRVIETYISRLYQPHLVKDSVQLKYKESGVIGI
WEFAEEHANIRNGQKPTLPEKRWGAMVILKSLESVSTAIGVALKDASHYSSSEGNIMHIA
LLGDDNQINKSEDSGDNDQAQDRIDKLSVILKQNIVTADLRAAGVKVVSCIVQRDGARMP
MRRTFLLSDEKLCFEEEPILRHVEPPLSALLELDKLKVKGYNEMKYTPSRDRQWHIYTLR
NTENPKMLHRVFFRTLVRQPTAGNKFTSGRTSDIEAGHAEESLSFTSSSILRSLMTAIEE
LELHAIRTGHSHMYLCILREQKLLDLVPVSGSTVVDVGQDEATACSLLKEMALKIHELVG
ARMHHLSVCQWEVKLKLDSDGPASGTWRVVTTNVTSHTCTVDIYREAEDTEAQKLVYHSA
TSLSAPLHGVALNNPYQPLSVIDLKRCSARNNRTTYCYDFPLAFETAVRKSWYNINTENK
QCYVKATELVFADKNGSWGTPLIPMDRPAGLNDIAMVAWILDMSTPEFPNGRQIIVIAND
ITFRAGSFGPREDAFFESVTNLACERKLPLIYLAANSGARIGIADEVKSCFRVGWSDDGS
PERGFQYIYLTEEDYARISSSVIAHKTQLTSGESRWVIDSVVGKEDGLGVENIHGSAAIA
SAYSRAYKETFTLTFVTGRTVGIGAYLARLGIRCIQRTDQPIILTGFSALNKLLGREVYS
SHMQLGGPKIMATNGVVHLTVPDDLEGVSNILRWLSFVPAKIGGPLPITKPLDPPDRPVE
YVPENACDPRAAISGIEDSHGKWLGGMFDKDSFVETFEGWAKTVVTGRAKLGGIPVGVIA
VETQTMMQLIPADPGQLDSHERSVPRAGQVWFPDSATKTAQALLDFNREGLPLFILANWR
GFSGGQRDLFEGILQAGSTIVENLRTYNQPAFVYIPKAAELRGGAWVVVDSKINPDRIEC
YAERTAKGNVLEPQGLIEIKFRSEELQDCMGRLDPELINLKAKLQAAKHENGTLPDVESL
QKSIEARKKQLLPLYTQIAIRFAELHDTSLRMAAKGVIKKVVDWEDSRSFFYKRLQRRIS
EDVIAKEIRGVTGEQFSHQSALELIKKWYLASQVAEVGNTEWDDDDAFVAWKDNPENYKA
YIKELRAQKVSQVLLDLGDSSSDLQALPLGLSMLLDKMDPSRRADFVEEIRKVLG
Download sequence
Identical sequences I1IWF2
XP_003581375.1.954 15368.BRADI5G03860.1 EG:BRADI5G03860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]