SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G02960.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G02960.1
Domain Number 1 Region: 9-286
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.21e-41
Family WD40-repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G02960.1   Gene: BRADI1G02960   Transcript: BRADI1G02960.1
Sequence length 316
Comment pep:novel chromosome:Brachy1.0:1:1988462:1990663:-1 gene:BRADI1G02960 transcript:BRADI1G02960.1
Sequence
MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKIVNIGGASAPSQLLATLTGHYGPV
WRVGWAHPKYGSILASCSYDGRVIVWKEGATGQWSQAHVFSNHKSSVNSIAWAPYELGLC
LACGSSDGSISVMSMQPDGGWDTATIERAHPVGVTAVSWAPATALGSMVGSDQLVHKLVS
GGFDCVVKVWEFVNGGWKVESALVSDMHAECVRDVSWAPVLGLAKSTIASASQDGKVVIW
TKGKGGDKWEGKMMRDLEAPVWRVSWSLTGNILSVAAGEGAITLWKETSDGQWEQLWTKA
SGEPQEQATEEVIAAQ
Download sequence
Identical sequences I1GLA6
15368.BRADI1G02960.2 EG:BRADI1G02960.1 XP_003563373.1.954 XP_010240532.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]