SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G07540.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G07540.1
Domain Number 1 Region: 179-396
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000023
Family Cystathionine synthase-like 0.013
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G07540.1
Domain Number - Region: 748-844,884-912
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000409
Family Cystathionine synthase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G07540.1   Gene: BRADI1G07540   Transcript: BRADI1G07540.1
Sequence length 930
Comment pep:novel chromosome:Brachy1.0:1:5292953:5296246:-1 gene:BRADI1G07540 transcript:BRADI1G07540.1
Sequence
MHLSLWKPLSHCAALLLDKKHRPPRPPPAGPGAGSGSGRRLQESKLREALEEASEDGCLT
KSRDAALLDGGDGGEEGGSVGRSRSLARLNAQREFLRATAVAAERAFLSSDALPALAEAL
ATFLSMYPKYSSSGDVDRLRADEYPHLDKVCLDYCGFGLFSYLQSCNLADSSVSFTLSEI
TANLSNHALYGGAEKGTAEHDIKNRIMDYLNIPESEYCLVFTVSRGSAFRLLAECYPFGT
NKRLLTMFDHESQSVNWMAQSARDKGAKAYSAWFKWPTLKICSTELRKQISTKKRRRKKD
SATGLFVFPVQSRVTGAKYSYQWMALAQQNHWHVLLDAGALGPKDMDSLGLSLFRPDFII
TSFYRVFGADPTGFGCLLIKKSVMSSLQSPHGGTGAGMVRIVPVFPQYLSDSVDGFDGVT
DGLEDDMIIPIEEESASDSHHASQLPAFSGAYSSAQVREVIECEMDQDSSDRDASSTIYE
ENESVSVGEVMKSPVFSEDELSESSFWVDLGHSPLGSDHSEQSSKGKLGSPLPASWFSGK
KNARKTSPKVPSKLARSPIYDNHVVSFDAAVRSVSQELDHVKEISEEDCSHNGKVSEIEE
YQEGKENRRFVKFSCANGPTEGSSVSVFGGCAANGNGSTSEICSESQVEAKDSAIRRETE
GDFRLLGRREVPNSRFNGGRLIGVEEAEVSSMGRKVSFSMEDSRLCRNADAGETSGYAVA
EDDDDDAYSDYDEIQDGRKEPEIICRHLDHVNMLGLSKTTLRLRYLINWLVTSLLQLRLP
DSGDGDGVPLVYIYGPKIKYERGAAVAFNIKDCNTGTSLINPEMVQKLAEKEGLSVGVGF
LSHIRIMDNQKHGVVDVGLSSSLCRPTSNSRHEKKNSKNALVGIEVVTASLGFLTNFEDV
YRLWAFVAKFLDSSFLEQERLSSIPEDAER
Download sequence
Identical sequences I1GMY1
XP_003558930.1.954 15368.BRADI1G07540.1 EG:BRADI1G07540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]