SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G09310.3 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G09310.3
Domain Number 1 Region: 1831-1978,2043-2181
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.04e-73
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0033
Further Details:      
 
Domain Number 2 Region: 14-23,65-129,221-358
Classification Level Classification E-value
Superfamily ARM repeat 0.00000838
Family Mo25 protein 0.037
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G09310.3
Domain Number - Region: 1169-1250,1363-1422,1536-1687
Classification Level Classification E-value
Superfamily ARM repeat 0.00125
Family MIF4G domain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G09310.3   Gene: BRADI1G09310   Transcript: BRADI1G09310.3
Sequence length 3629
Comment pep:novel chromosome:Brachy1.0:1:6681692:6700747:-1 gene:BRADI1G09310 transcript:BRADI1G09310.3
Sequence
MTSYAVRRAAVAAYAALSAVLCAHEAPGGLPDGFVAWALPLLGEPASAPLVAEGLRELLS
TGDVPAVERFVPPLLASCRDVLEDDRTSLAVLRCLLGLLTLVAAKFPHCFRPQFVDIVDL
LLGWVFVPDLADTDCRTILDSFLQFQWHWLGNLQFSLGLLPKFLADMEVLVQDPNLAASH
NSGRLRPLFSCFSTVLQIMASGVAERNNLRELVVGPLEGLAPQLLRCASVIASKLGWSER
MEEASRCLVLLAEILQERFAEFYVKFVDVLVQSLENASSLQLVAALKTNLQVLSLQNLGL
RATAVEYLLDFSSLLSRLRLHPNHNVVVNSSATYLFCLQHGSEDVIDQAIASLMKELELL
KSLLEKVQVSNLDIQSLSLNNNTLAGHSEHQLLSIMKFDLKILLATISADYEKSNMRVTS
LASFISEKLDPFGAPFHDFLELQFQIFSTLHKLSNVELSSNIKTSEVFKKGPGDSGSQTQ
MIAESKKSFCDCKMKFMHKYGKHIVRGLNASSSMTLKLDALDWIDSFAKMVLTMERGLDK
VGLSHEVFGDATVANNVLFTILDCAYDRETKVRCHVALSLEALFLGRLIDPMSFSVVAQV
LLDKLSDPDNDVKNGFLRLFSIALPITTYTFGLLEDGRSFQNSLDTSNSSKDCMSLRHVL
AVKQQPRKLHWQQLVSILSYLSLRLKLPLSSWVQRLVFSYRGKKDMFSGQIDVSGDADWN
ELFKWPDVDRTIIDRMYSVNNLAAVWWGIHEAARHCINLRLRTHLGGPTQTFAALERMLL
DVPNLLAHESNEGEGRYIGPSDICLLPMRLLLDFVEALKKYVYNAYEGSFVLPAPPKASS
LFFRANKRVCEEWFSRICDPMLNAGLALQCSDAVIHYCSLRLVDLRNLAASSLKDSSRMG
GVTESHHALRERLEVDVLKVLRHASLALCRCHETDALIGLQRWAVSTYYTYFDLDKQLMR
GVSDSHKHFFWMSGLIYQSQGQYEKAAAHYSHLLQSEEALTSMQSDIIQYIIARVIECYT
ALSDWKCLEGWLAELQELRAVHAGKPYSGALTSAGNELNAVHAMACFDEGDFHSAWSYID
LTPKSSSELTLDPKVALERSELMLLRAMLQSDSKPDRSREDLDRAKLILDEALSVVPLNG
LTEATACAGQLHCIFAFQEATGLTSQNGPNQSPQLMDYVQRLLQDPIDRIHQDCSMWMKV
LKVYRTTHPSSLPTLLLCRKLASLARKQSNFMLAGRLNQYLINHPLDSSDDMDKQMLTLN
IKYEGAVLKYHEGKIEEALTDLWLLVRPSVLSTGNDSSGIDNSLIAKACLKLSAWIEQES
STPTLNAVLPKMIKDFSDFDGFRNGAEKFLSGDSGSVSTSNHDALAQEIVGSARKISWQL
CPSMGKAWLSYASWCFTHASRFLSGPDSNLQNQLSSILQSELSPDRYHLTDNEKSEVERI
IRSFCVNKDADYADHNFPETTGCSYNSEQEYSITSLIEHATRLLETAAGAPGSEAGDGDG
AYAVLSSDLTILFCKCDSTKDNAMPLIDKLIEIWWSLRRRRVSLFGHAANAFFHYLSHSS
TELQPSYHRDSLKGKTRGYTLRALLYILHIILNYGVELKETLESGLSSVPLLPWQEIVPQ
LFARLSSHPEKIVRKQLESILVKLGKLSPCSIVYPTLVDINASEGEPSEELQRILDFLVK
LYPKLIKDVKLAIDELGMITVLWEEQWLSTLQDLHSDVIRRINILKEEAARVSANSTLTS
AEKNKINAAKYSAIMTPIVVALERRLASTSREPRTSHEMWFHKEYNAQLRSAITTLKIPP
ASSATLGEIWRPFDSIAASLATHQRKSCILLSEIAPQLAALSTSDIPMPGFEKQILGSPE
SSFAGNHGTITVSSFCKEVTILSTKTRPKKLVLQGSDGHKYIYLLKGREDLRLDSRIMQL
LEAINSFLHYSSDTRSRDIAIRFYSVTPISGRAGLIQWVENVSSIYNVYKSWQKRSQVAQ
AQLSSVSSGNVQNSVPHVPRPSDMFYGKIIPALKEKGIKRVISRRDWPLDVKRKVLLELM
KETPKQILWQEMWCSSEGFRNFNSKVKRFSSSLAAMSIVGHILGLGDRHLDNILMDFSNG
DVVHIDYNVCFDKGKRLKIPEIVPFRLTQTIESALGLTGVEGVFRVTCETVLSALLKNKD
IILMLMEVFVWDPLIEWTRGNMQDEAGIAGEEKKGMELAVSLSMFSSRIQEIRVPLQEHQ
DLFVTNLPATLSALKKFLDTLDQYEVISAMFYHVEKERSSALHNETSAKSIFAEATSVVE
KSCTSFELHAHELAEAKAATVDEANKLAIWVEKHGRVLEAIRDNSITGAESCMQLDSKDE
ALSLISAVLVSGVPLTVVPDPTRAQCYELDREVSQLITELHDGLSCALEALGEYALVLQQ
VLPVNYITTSPITGWAQALQLSVTSSSQDMLTLAKRQAAEVIAKVQGEGINLVQQRYRDL
LNQMESYVACVERIATECSELMNSVGLNNEAQSKDRILSAFVNSVQLLSQNNDEDSISFS
QTDNLEVKTQSQEDVQEKTSKVLSILGIAVGKLYSEVRTKVSELSSKAVRISKFRTDEAG
VQADAGMNLQLIDQQIEKCALVSGFVNEVHEVIGIKIGEMNTDYTKPRPGQWASTFQAIL
HSSTNMIEQMTEVFLPEIIRSFVSYNSEVMEAFGSVSRIHGSVDTALHKLTEVELERASL
SELEQSYFVKVGRITEQQAALEEAAMRGRDHLSWEEAEELASQEEACRAQLEQLQETWGQ
KDMRISSLIKLEANVMNSLLSSEQYFSSLVNIDQENEFHSRSKALLSILTKAFADLESLD
HMLSSRGAFTSHIDGSLSNLRDVLAASSSLSDVMWPLSGLLKDHTFFVWKLSLLDSILDL
CMREISSSVEHSFTTNQLYITLKKKLAIHVEEQICQYIFKRIAPALILHLDKEIRDLLQV
SQGRRESGQPKRDSAAVGRAAVMLEEYCNAHETDRAAQTAISLMRRQLNELTEALRKIVL
EIVQVEWLHDLSSPHAQKAKVFSQNILKDDKFISMLLNLSRSNLLDKIQSSVSLVTRSIE
CLQACESTSVSAEGQLERAMGWACAGPNTSGAGGSTAKGSGIPPEFHDHLLGRRKLLREI
QEQASDLVKSCSSVLEFEASRDGLYLISEDKSSGQSTDKGRAWHQTFLNLLTRLDAAYHS
FTCAEQEWKLGQLNMETAGKGLYSATNQLSVVSVKAKSALVNLQDTLVDLYERACEVSSS
LSGFKHISQDRTALTAESGSLLEEVLAIAEGLHDVYTLGKEAAALHSSLVTNISMANTIL
LPLEASLSADLAVMSEAMSNEREKNNTSMPLVHGKALYQSYIIRVREAYKNLEPLVPPLT
EYVKELHSMVIKLGRLSSLHAGNIHKALEVLEESETARSEDMPSARPDLLQSDSSIEKDK
SSSGSREGASQDLIMDTDVSLQDECWISPPEHSYTSSSECTTGLTQLTSENLEKIDSLLD
GDPGIEGPCANSQETRDGRTDSESDSSSNKHASLNNVTLTQASNIHEAETSLVEEGKIET
ENNIGAFKQVRGQECDSSDNKSYSDSVTRARGKNPFALSILKQVEHKLHGWDIDGTRSFK
ISEQVDHLVKQATSIDNLCNMYEGWTPWI
Download sequence
Identical sequences I1GNI9
15368.BRADI1G09310.3 EG:BRADI1G09310.1 EG:BRADI1G09310.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]