SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G09530.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G09530.1
Domain Number 1 Region: 178-334,535-669
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.05e-38
Family WD40-repeat 0.0046
Further Details:      
 
Domain Number 2 Region: 17-122
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000733
Family WD40-repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G09530.1   Gene: BRADI1G09530   Transcript: BRADI1G09530.1
Sequence length 815
Comment pep:novel chromosome:Brachy1.0:1:6826242:6832668:-1 gene:BRADI1G09530 transcript:BRADI1G09530.1
Sequence
MEKLRVHRCGGGAVAWTPSPIVALATSPCASQVAAARGDGSLELWLVSPGSVGWHHQLTI
HGSAQSMVTALVWVPSGAGGRLLSSSIDGSVAEWDLFHLKQKNVLDSVGVPVWQMAMEPT
DDPLNSENKSSGCASNGRANHNGRTDSDLSYVDDGDSFDDEDDSAKTSSPYRVNEFQRLA
LACDDGSVRLYNVPESGSLTYYRSLPRVSGRILSVTWSNNAKFIFSGSSDGLIRCWDSTS
FHEKYRMTAGLGGAGSGSEFCIWSLLFLRCGTLVSGDSSGTVQFWDSRHGTLLQAHSYHK
GDVNALATVPSQNRIFSAGSDGQVILYKASKDEFGADNEKVAKDQMHKWAYVGYVRSHSH
DVRALTMAVPICKEDAPPEEKVVKKIRQREKPVDSYHKWAHLGVPMLISGGDDTKLFAYS
AREFTQFAPHNFCPAPQRPLINLARDGTVNGDSVMLVQSANWLDVLLVSVQNNLIPSTSS
RGDATIRQVVRLKSKGSRKIVSSAISTNGMLLAYSDCVKPCLFALRHKGGKKYALDKVEL
PKGIPSSQSMMFTADSSNLVLACCDGKIYVVDIATKEISNVFHPTRKMDGEKPSSKEPPV
TKMFLSVDGQWVAAANCFGDVYIFNLEVQRQHWFIPRMNDGSVTSGGFCPKNNSLVITTS
KNEVYIFDVEAKQLGEWSKRYTHHLPRRFQEFPGEVIGLSFPPLSSSSVVVYSARAMCVI
DFGLPVVQDVQLSNGSVVPAEKINQQKGTKSKIKRKDRDEEMKLEKRNNFDFFAFKDPVL
FVGHLLDSSALIVEKRWMDVVEGFGPPVHRHIYGA
Download sequence
Identical sequences I1GNL4
XP_003560086.1.954 EG:BRADI1G09530.1 15368.BRADI1G09530.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]