SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G14250.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G14250.1
Domain Number 1 Region: 295-421,449-510
Classification Level Classification E-value
Superfamily RNI-like 3.53e-16
Family 28-residue LRR 0.054
Further Details:      
 
Domain Number 2 Region: 111-147
Classification Level Classification E-value
Superfamily F-box domain 0.0000549
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G14250.1   Gene: BRADI1G14250   Transcript: BRADI1G14250.1
Sequence length 575
Comment pep:novel chromosome:Brachy1.0:1:11139069:11145859:-1 gene:BRADI1G14250 transcript:BRADI1G14250.1
Sequence
MASLPTKPPPPPRPKTRGSYNCGRCGLPKKGHVCNLPSPADGGAPTPSPSSSGAASGENR
LRRALSFDDAATPTSPEKKPRAAGDEEEADEADGQMEEDEERMELGGRAWPRELVADVLR
RLGPRGVMAAAAVSRGWRDCAGRVWRATEELRLRAVGVGLLGALLPRCTALSRLVLRMES
DVDAAMLACLAFSCSSLETLEITMADKAVNRMTGEELSRFVSEKRSLSVLKIGGCSSLGF
LDLSSSSLSVLWLSDLCSLSKSVINCSNMSELSLCFTQQSNDCTDLVALMDGLGRMCPNL
RNMHISSIQLSNEAVFALENANLRGLCMLSLILGSKITDAAVASIVRSCASLDLLDLSGS
SISDSGVGMICKAFPHTLSRLLLALCPNITTCGIQVATAQLPLLQLMDCGMSLRSNSQNE
KQGAYFGEINGRIRLCPKLPTLKKQPMRQKLIIKHDNLKKLSLWGCSAIDALYVKCPELN
DLNLNSCTNLHPERLLLQCPNLKNVHAFGCQDMLIGAIRNQVLNEFAAAEPHLPCKRLAD
GSKRVQLPQLPEKQSPEDKKCTGFRGTQCAVLLDS
Download sequence
Identical sequences I1GQ64
EG:BRADI1G14250.1 15368.BRADI1G14250.1 XP_003562225.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]