SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G14530.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G14530.1
Domain Number 1 Region: 22-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-20
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 458-565
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-20
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 3 Region: 248-348
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000235
Family B3 DNA binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G14530.1   Gene: BRADI1G14530   Transcript: BRADI1G14530.1
Sequence length 568
Comment pep:novel chromosome:Brachy1.0:1:11474372:11477676:-1 gene:BRADI1G14530 transcript:BRADI1G14530.1
Sequence
MARLESQVQKSCDCCKTYVGHLEGKMKCFQRHMTADFRHGMIIPNKFMDHFGGKISRTIE
LESPDGNTYVVEVSKNLSKKSPCHGWEAFLDAHHIEENDSLLFRHIKNSRFEVLVLDSDD
CEKVFSCVGIKVTCNVQERSSDYDDISNSSYADTTKSSGSKEFASCERVHSSHPRKTAKT
PAKYSSSEDSDAGEDTEDICSEYESSFQLDDLQTPLGCDYVLCHRSAQPGVHEEKVTRLL
QDKDIRAEAPLLVAIIRQSNLKSRSSGLVIPKGYAAEHLPHKSQTVILQRPGKNKKWYHR
FHIRKDGCAFLRLLGFLRDNQVQEGDICVFEPMKGTGKKFSLKVHLLRESIHGGSGTGPK
RVSSPHGKSRVSSATHIRISTTHGRTRANATPKTRVKEELDHGRSHPYSGSNHGHRAHKQ
PLESDEYEEPVERPYMLSDIACLTWEQEKKVKRRVDAIQSEVPIYVSIMNNSSVGANRLY
HLTIPKKYAAKYLPAGGHTLRLLRPERSKTWDVEMHPRVGGAKMLRGGWHEFANENRLQV
QDLCLFQLMKNERRLTMMVYIIRHNDKR
Download sequence
Identical sequences I1GQ95
15368.BRADI1G14530.1 EG:BRADI1G14530.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]