SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G28810.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G28810.1
Domain Number 1 Region: 92-224
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 3.43e-30
Family 4HBT-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G28810.1   Gene: BRADI1G28810   Transcript: BRADI1G28810.1
Sequence length 227
Comment pep:novel chromosome:Brachy1.0:1:24153318:24154566:-1 gene:BRADI1G28810 transcript:BRADI1G28810.1
Sequence
MQSPAVNNNAKLSPVHQVAISAAAGARRVSGAGNNDLAVVLQRRPHRPVGALLAVAPPNA
SALAEAVCTTTTAKNNTNNEKQLQDVIKLREDKYFETEMTVQDCELDKYGVVNNSIYASY
IEKAREELLLSLGISTGLIICTGNLLALSELNLKYYTPLRRGDKFVVRVRLVRIKGVRIF
AEHIIETMPDRKLVVEATATVVCLNKDYRPTRVFPEMSDKLQRFFST
Download sequence
Identical sequences I1GUU1
XP_003563181.1.954 15368.BRADI1G28810.1 EG:BRADI1G28810.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]