SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G46602.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G46602.2
Domain Number 1 Region: 117-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.28e-43
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 962-1026
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000446
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G46602.2   Gene: BRADI1G46602   Transcript: BRADI1G46602.2
Sequence length 1063
Comment pep:novel chromosome:Brachy1.0:1:45117520:45123919:-1 gene:BRADI1G46602 transcript:BRADI1G46602.2
Sequence
MKDQGSAGVSPGPPEGEKKAINSELWHACAGPLVAMPPVGSLVVYFPQGHSEQVAASMNK
EVDVIPNYPSLPSKLICKLLSLTLHADSETDEVYAQMTLQPVSKYDRDAMLASELGLKQN
KQPMEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFAMQPPAQELMAKDLHDISWKFR
HIFRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFIRDEKSQLLLGIRRSTRPQPALSSSVL
SSDSMHIGILAAAAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRML
FETEDSGVRRYMGTITGIGDLDPVRWKNSHWRNLQVGWDESTASERRTRVSIWEIEPVAT
PFYICPPPFFRPKLPKQPGMPDDENEVESAFKRAMPWLADDFALKDVQSQLFPGLSLVQW
MAMQQNPQMLPTSAPAVQSPYLTSSALALQDGMGTGNEDPTRRLNIQGQNIGLPNFQVGS
KIDHSVMAQHQQQPHQLSQQQQVQPSQQSSMALQQQQAQLLQQNAIHLQQQQEHLQRQQS
QSQQQQEHLQRQQSQPQQQLRTAEAMEQHKLREQQPQGGQAVSQAQLLSQIFQPSSSQLQ
QLGLPKSPTQRPGFPGLQTAGALQQPALTQTPQVQQAAEYQQALIQSQQQQLQQLSQPEM
QLQLLQKIQQQNMLSQLNPQHQSQLIQQLSQKNQEFLQQQILQHQLGGSDVLGQFKQSQQ
TPSKHMTGSLTPQQLVRSQSALAESEDPSSSTAPSAGRISPMNSLSKTHHSSRNLTEMTT
SPHIDNLLQEIQSKSDNRNKNDRQGSKETIPVPNRYPVSDQLDASSATSFCLDESPREGF
SFPPVCLDSNAQVDPRDNFLIAENVDSLMPDALLSRGMASGKGICDLPSGQRDHREVENE
LSSAAFSSQSFGVADMSFKPGCSGDMAVNDGGMPSQGLWNNQTQRMRTFTKVQKRGSVGR
SIDITRYRNYDELRHDLACMFGIQGQLEDPYRMDWKLVYVDHENDILLVGDDPWEEFVSC
VKSIKILSSVEVQQMSLDGDLGGIPSQTQACSASDDANAWRGS
Download sequence
Identical sequences I1H027
XP_003564148.1.954 XP_014753144.1.954 EG:BRADI1G46602.1 EG:BRADI1G46602.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]