SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G49290.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G49290.1
Domain Number 1 Region: 21-95
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000667
Family F-box domain 0.0087
Further Details:      
 
Domain Number 2 Region: 464-505
Classification Level Classification E-value
Superfamily F-box domain 0.000000131
Family F-box domain 0.0089
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G49290.1
Domain Number - Region: 647-736
Classification Level Classification E-value
Superfamily Kelch motif 0.0915
Family Kelch motif 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G49290.1   Gene: BRADI1G49290   Transcript: BRADI1G49290.1
Sequence length 759
Comment pep:novel chromosome:Brachy1.0:1:48071931:48074210:1 gene:BRADI1G49290 transcript:BRADI1G49290.1
Sequence
MVPPQPTTNNKRSKNQQQQPSLPEETLVEIFSRLPAKSVGRCRCLSRSWAAALSSASFVD
LHYYHQQQANQNCQNQQQQPKLLFATAQRCLHAWQWRVPVDDGGAAPALVHQLALPQMDP
GCALRVLTPKPCHGLVLLHRWPYYGHYVCNPSTGALLPLPDTKAPSRMCGRYSIPCTYQN
SVSYGLGCAGSSSASTKEHKVVRLLSLQEGSATTSCACEVFSLDGGAVPHWRPAAQRAPS
CTLRPRSAAVFFDGRLHFLQHEGGGCIVTLGVCHETFGSLKPPAGLDTRRVSFELAVLDG
RLCLYYGHDVGDPDFRHGIDDEGDYISCNDDYCIWQLRSYHGAGEWEQLCCIQRQSLPEA
LLHVDRISPLEIYRGRNGHRMIMFAASANLTVFTVDMDDLIDHDCGRAPPEMILLAPPTG
NAVVDSFVETDPCSHAVGLLEESLVPLGRPSEEIIFSWPSTKAWSEVLKWLPTRCLVPLR
RVCKDWRVLINSNRFMQLHVTTQIKMSPRRILLIETEFGSFWPLEEAARGRELHVQQMDQ
FLFFGGSTRRSRVVCSKPSHGLVVGSCTDCMGISSDFICNPTMGYFKKLFPDPQGGDASG
FLAGRIGLGYDSREKKHVRVRLVYSKRNMHTRDYQLGCHVQLTDTESSWRPIRPPPRPVA
EMQSAYAHGKLYWIVDALAGTTSGCEILALDVGTEEFQVLQGPQYCNYDRITSIVELQGN
ICLVCSERSTNDMDIWKLEEGGLWSIWCRVELEEFSQEY
Download sequence
Identical sequences I1H113
15368.BRADI1G49290.1 EG:BRADI1G49290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]